CAZyme Information: PMAA_082840-t26_1-p1

Basic Information

• Species: Talaromyces marneffei
• Lineage: Ascomycota; Eurotiomycetes; ; Trichocomaceae; Talaromyces; Talaromyces marneffei
• CAZyme ID: PMAA_082840-t26_1-p1
• CAZy Family: GH76
• CAZyme Description: glucose-methanol-choline (gmc) oxidoreductase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
557		60433.06	5.1402

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TmarneffeiATCC18224	10194	441960	145	10049

• Gene Location: location=DS995901:1682544-1684334(-)

Full Sequence      

MAPPEVNEVFDIIIVGGGTAGCVVASRLRQRKPTLSILVLEAGGDLSKNPHVYSPETAPL
LLGSDADWKYTSVPQVNLNGREIYYQAGKGVSGSAAVNMGAWTRGDAQEYDRWADLVSDQ
RWSYEGLLPYFKRTEHHYNPHVGDAEQHGFKGPIHTSSVSSSGRQYPLRETLRQAWCNTG
LKGVDDANNGHPQGVTELVSNWADGRRQLTSEVYPLHGAVNVVTNALVRRVILDSSFTAT
GVELADGRIYSVRNGGEVIVSTGALRTPQILMLSGIGDSKQLSKYNIREFIHLPEIGRNF
HDHLLAFRYWKLREPEKGVALGSPLFGGPNFEKGVPPEDWLVTTTISSTGLHSAQAKDDE
NGPVQEVVDLRSHLELATIYAAFGGELIGLDIPMDGSAIMSFIMGFLPTSRGSITLKSAD
PADPPVIDPNFFATEADRFVMREGWRLLSRLMFETPEGKDLVAEEIVPEGHRSLESDAPD
DLIDAHIQMGGMTGSHFAGTASMGSVVDGSLKVRGTQGLRVVDASVIPTPLACHYQAAVY
AIAEQAVDIVLQENPGL

Enzyme Prediction     

No EC number prediction in PMAA_082840-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	9	552	7.2e-140	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	2.02e-94	3	555	1	538	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	1.48e-91	7	555	3	536	choline dehydrogenase; Validated
398739	GMC_oxred_C	1.84e-41	408	546	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	3.40e-33	79	304	15	217	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	4.77e-23	7	539	53	565	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA16662.1|AA3_2	0.0	1	557	1	557
QKX52976.1|AA3_2	7.58e-302	7	557	11	562
ATZ56754.1|AA3_2	6.19e-185	7	550	4	544
BCR96857.1|AA3_2	1.57e-164	7	550	4	547
BCS09345.1|AA3_2	1.57e-164	7	550	4	547

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4YNT_A	2.46e-64	10	553	6	567	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
5OC1_A	3.14e-58	10	550	2	561	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	3.20e-58	10	550	3	562	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
3Q9T_A	5.30e-56	10	557	7	576	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]
5ZU3_A	7.35e-56	10	557	7	576	Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_B Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_C Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A1L9WN49|ACUG_ASPA1	6.94e-118	7	553	2	521	GMC-type oxidoreductase acuG OS=Aspergillus aculeatus (strain ATCC 16872 / CBS 172.66 / WB 5094) OX=690307 GN=acuG PE=3 SV=1
sp|Q988C9|4PADH_RHILO	3.30e-67	8	556	5	539	4-pyridoxate dehydrogenase OS=Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) OX=266835 GN=padh1 PE=1 SV=1
sp|P9WMV5|Y1279_MYCTU	4.58e-67	11	550	6	526	Uncharacterized GMC-type oxidoreductase Rv1279 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv1279 PE=1 SV=1
sp|P9WMV4|Y1279_MYCTO	4.58e-67	11	550	6	526	Uncharacterized GMC-type oxidoreductase MT1316 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT1316 PE=3 SV=1
sp|P64264|Y1310_MYCBO	4.58e-67	11	550	6	526	Uncharacterized GMC-type oxidoreductase Mb1310 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) OX=233413 GN=BQ2027_MB1310 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000046	0.000003

TMHMM  Annotations     

There is no transmembrane helices in PMAA_082840-t26_1-p1.