CAZyme Information: PMAA_082470-t26_1-p1

Basic Information

• Species: Talaromyces marneffei
• Lineage: Ascomycota; Eurotiomycetes; ; Trichocomaceae; Talaromyces; Talaromyces marneffei
• CAZyme ID: PMAA_082470-t26_1-p1
• CAZy Family: GH74
• CAZyme Description: beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
842	DS995901|CGC3	92153.33	5.7227

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TmarneffeiATCC18224	10194	441960	145	10049

• Gene Location: location=DS995901:1595075-1597746(+)

Full Sequence      

MVQLDIEKTLSKLDLHDKIALTAGNDFWHTVPIERLNIPSVRTSDGPNGVRGTRFFNGVP
SACLPCSTALGSTWDVELLEQIGELLGDEARSKGVHVLLGPTINIQRSPLGGRGFESFSE
DGLLSGILAGHFCKGVQSKGVGATLKHFVANDQEHERMAVDTIVTARALREIYLLPFQQA
LRICQTACFMTAYNKINGTHVSENASIIDDILRKEWKWKGLIMSDWFGTYSTSKAINAGL
DLEMPGPTRWRGSNLAHAVNSRKVADHVLDERVRNVLKLVNHAKESGIPFDAEEKGLNRP
EDQKLLRRAAAESIVLLRNNNNVLPFDKNKSIAVIGPNSKVASYCGGGSASLPAYYTVTP
FEGISNASKADVKFSQGAYAHQTLPPLGPLMQTLDGKKQGFEFKAYLDPPEERNSDSKLV
DELHLVNSFGFLADYKNPRIPGSLFYADMEGTFTPEEDGLYDFGVIVIGTGKLFVDGELV
VDNATTQRQGIAMFGNATVEEIGSKELKAGQSYKILFQYGSRPTSKLESRSVIDFGLGGF
SFGAARRLNPEESIQQAVDLASKTEQVVVVAGLNGEWETEGHDRENMDLPPGTDELISRV
LDANPNAAIVIQSGTPVTIPWADKANVVAQAWFGGNELGNGLADVLYGDVNPAGKLSLTI
PVRLQDSPSYINFGSERGRVLYGEDVYVGYRYFEKAAVKPLFPFGHGLSYTTFTRSDLSL
KVDAEKPILEDGEKITASVTVTNTGSVGGAETVQLWIQPPILENIKRPARELKGFTKVYL
QPGEKKTVSITVEKKIATSFWDEIRKSWASEKGDYTVLITGTGDEKLSTQFSVEKSRYWL
GL

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	33	245	1e-63	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	1.22e-81	35	819	101	750	beta-glucosidase BglX.
224389	BglX	1.73e-73	15	369	40	396	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	1.34e-48	314	690	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
395747	Glyco_hydro_3	2.23e-38	31	279	59	316	Glycosyl hydrolase family 3 N terminal domain.
178629	PLN03080	5.46e-35	37	793	97	743	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA16623.1|GH3	0.0	1	842	1	842
QKX61249.1|GH3	0.0	1	842	1	839
ATQ35958.1|GH3	0.0	1	842	1	839
AJA36818.1|GH3	0.0	1	842	1	838
BAE61980.1|GH3	0.0	1	842	1	839

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	1.29e-266	1	842	1	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	4.98e-261	5	842	5	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	2.20e-147	5	819	4	653	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	1.87e-108	9	828	8	656	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
4I3G_A	2.81e-96	33	827	87	820	Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae],4I3G_B Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0CAF5|BGLI_ASPTN	0.0	1	842	1	839	Probable beta-glucosidase I OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=bglI PE=3 SV=1
sp|B0Y8M8|BGLJ_ASPFC	0.0	1	842	9	865	Probable beta-glucosidase J OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglJ PE=3 SV=2
sp|B8NDE2|BGLI_ASPFN	0.0	1	842	1	839	Probable beta-glucosidase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglI PE=3 SV=2
sp|A1CA51|BGLI_ASPCL	0.0	1	842	1	838	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1
sp|Q4WU49|BGLI_ASPFU	0.0	1	842	1	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999657	0.000366

TMHMM  Annotations     

There is no transmembrane helices in PMAA_082470-t26_1-p1.