CAZyme Information: PMAA_081560-t26_1-p1

Basic Information

• Species: Talaromyces marneffei
• Lineage: Ascomycota; Eurotiomycetes; ; Trichocomaceae; Talaromyces; Talaromyces marneffei
• CAZyme ID: PMAA_081560-t26_1-p1
• CAZy Family: GH72
• CAZyme Description: cell wall glycosyl hydrolase YteR, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
398		44966.64	4.9018

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TmarneffeiATCC18224	10194	441960	145	10049

• Gene Location: location=DS995901:1342802-1344117(+)

Full Sequence      

MRLSQLLRSLTLSITVTAATTTNNYSTWMADSIISRGQGIAPETPTASTYLQIGIVQHAL
LQLLDSPVASFSAKEKYRAYVQRGTESILGKFLNASQDALYPLDRFSLGRGLLEVYIDDV
DRQTVKEGLDVLNESIALQPRNQYGGLWYFTYPNWSYLDGMYSYTSFASLYTTHFNPGAT
PETTHDIIDQLDLLWSHCFDNTTDFLFHGYDASKTAVWANPITGASPIVWGRAMGWYFMA
LINWLELNYFLQLEESLQWRYVQSRFVSLANALVRAADPVSGAWLQVLNHPGREGNYIES
SGSAMFVYGLYKGVRLDYLPQQQKYRETADKAYEYLARMFVVNNENGTLSWNGTVSVCSL
NSTADYQYYVMQPLLFDSVHGSASFVLASLENEIQARL

Enzyme Prediction     

No EC number prediction in PMAA_081560-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	54	391	3.6e-67	0.9367469879518072

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
400034	Glyco_hydro_88	1.64e-37	68	391	41	338	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
226678	YesR	7.37e-36	74	391	54	352	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA16534.1|GH105	6.35e-295	1	398	1	398
QKX54638.1|GH105	1.40e-178	7	396	5	409
QRD85043.1|GH105	1.51e-137	22	393	38	416
UDD61061.1|GH105	5.66e-135	22	393	38	416
BAE63195.1|GH105	1.27e-132	22	393	38	411

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	1.48e-47	25	393	4	359	Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	4.43e-32	103	393	87	365	Structure of Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	1.88e-31	103	393	77	355	Chain A, Putative glycosyl hydrolase yteR [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O34559|URHG2_BACSU	2.28e-31	103	393	87	365	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
sp|P0A3U6|PIC1_AGRFC	4.99e-22	208	397	42	233	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
sp|P0A3U7|PIC1_RHIRD	4.99e-22	208	397	42	233	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.755420	0.244598

TMHMM  Annotations     

There is no transmembrane helices in PMAA_081560-t26_1-p1.