CAZyme Information: PMAA_080050-t26_1-p1

Basic Information

• Species: Talaromyces marneffei
• Lineage: Ascomycota; Eurotiomycetes; ; Trichocomaceae; Talaromyces; Talaromyces marneffei
• CAZyme ID: PMAA_080050-t26_1-p1
• CAZy Family: GH71
• CAZyme Description: cell wall glucanase (Scw4), putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
408	DS995901|CGC13	45109.40	7.1636

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TmarneffeiATCC18224	10194	441960	145	10049

• Gene Location: location=DS995901:903321-904663(+)

Full Sequence      

MKYWFLGIAALALLHPTDGHVHHHHQLSKRALRHEGAAQPCPKATLTNTVIVQLDQAGHT
VDVRVQSARPSVHREVSTSSVSSPKTRTSASSTSKIAQSNRHIIPQPSALSHLPDPLDLN
LLHDPSIPFFGKRSNYGISYSPYKADSTCKNQDEVSNEIKKLRQFSFVRFYGIDCDQAET
VTNAARQNDMRVFAGLYNIDDIERDLKKIIEAADGDWSTFHTVSIGNELVNRGAKSPEEV
VGAVNSARTILRRAGYQGPVVTVDTFNQMIAHPELCDESDYCAANCHAFFDSNQTPENAG
PYVLEQARHVSQATKHGNKPVLITETGWPSAGEPNGNAVPSRHNQMIAFKSLRRSFPQGG
IVFFSAFDDKWKQDNAWTFDTEKHWGLYGLAKSVGGFPHLIGSLEDEA

Enzyme Prediction     

No EC number prediction in PMAA_080050-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	144	388	6.6e-24	0.9356913183279743

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	5.48e-76	77	388	5	301	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	6.53e-07	306	388	213	297	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA16381.1|GH17	1.87e-308	1	408	1	408
QKX63568.1|GH17	3.11e-144	1	394	1	419
ACQ00076.1|GH17	8.71e-104	50	392	23	366
CAK47997.1|GH17	4.75e-103	107	387	77	360
CAP97696.1|GH17	4.23e-101	136	388	124	381

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	1.60e-16	131	394	33	288	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]
4WTR_A	9.86e-16	131	394	33	288	Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaribiose [Rhizomucor miehei CAU432],4WTS_A Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaritriose [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q59XX2|MP65_CANAL	4.32e-72	137	388	128	376	Cell surface mannoprotein MP65 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MP65 PE=1 SV=3
sp|P53334|SCW4_YEAST	3.73e-65	137	387	135	382	Probable family 17 glucosidase SCW4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCW4 PE=1 SV=1
sp|Q04951|SCW10_YEAST	7.99e-65	137	387	138	385	Probable family 17 glucosidase SCW10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCW10 PE=1 SV=1
sp|Q2US39|BTGE_ASPOR	4.67e-38	137	386	348	596	Probable beta-glucosidase btgE OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=btgE PE=3 SV=1
sp|B8MXP5|BTGE_ASPFN	4.67e-38	137	386	348	596	Probable beta-glucosidase btgE OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=btgE PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000264	0.999701	CS pos: 19-20. Pr: 0.9808

TMHMM  Annotations     

There is no transmembrane helices in PMAA_080050-t26_1-p1.