CAZyme Information: PMAA_079830-t26_1-p1

Basic Information

• Species: Talaromyces marneffei
• Lineage: Ascomycota; Eurotiomycetes; ; Trichocomaceae; Talaromyces; Talaromyces marneffei
• CAZyme ID: PMAA_079830-t26_1-p1
• CAZy Family: GH67
• CAZyme Description: alpha-1,6-mannosyltransferase subunit (Och1), putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
363		41344.10	5.6381

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TmarneffeiATCC18224	10194	441960	145	10049

• Gene Location: location=DS995901:831220-832365(-)

Full Sequence      

MKDLESRYYPARTSTMARTRRAIIAFALLVSIILLFRSFSASTIYDSPLLIPPQARGRAG
TFESQLTIGDTTYPTLLEKLRHQYPYDLDSKFPAHIWQTWKYSVSSSSFPQHFRYLESTW
TDTNPEFVHEVISDESAVHLVQYLYGSMPEVVEAYNSLPAPVLKADLFRYLILLARGGIY
SDIDTEALKPVVDWLPEDMDPSSVGLVIGIEADPDRPDWHQWYSRRIQFCQWTIQAKPGH
PVLRDVVATIVEDALRMKKKGILTMSKLDKSVMEFTGPAVWTDAIFRYFNNPDYFISEGT
GNVTYEDFTGLTIQKKIGDVAVLPITSFSPGVDQMGAKGLDDPLAFVSHRFEGSWKPQNE
RIY

Enzyme Prediction     

EC	2.4.1.257:12

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	118	197	1.6e-19	0.9

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	1.54e-41	73	356	63	345	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	7.26e-19	110	198	1	90	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA16359.1|GT32	7.08e-272	1	363	1	363
QKX63547.1|GT32	5.09e-174	46	361	46	362
CBV36935.1|GT32	1.15e-151	20	356	5	354
ACQ06321.1|GT32	6.07e-149	14	355	54	408
EAA60758.1|GT32	1.39e-148	20	356	5	357

PDB Hits     

PMAA_079830-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5A4E3|OCH1_CANAL	2.87e-95	75	356	82	376	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|Q9UTR6|OCH1_SCHPO	5.90e-77	85	356	137	394	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|P47124|HOC1_YEAST	6.41e-73	75	356	113	388	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|P31755|OCH1_YEAST	2.12e-72	50	361	52	475	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|Q10323|IMT3_SCHPO	2.01e-06	73	194	34	155	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999428	0.000584

TMHMM  Annotations     

Start	End
22	41