CAZyme Information: PMAA_076970-t26_1-p1

Basic Information

• Species: Talaromyces marneffei
• Lineage: Ascomycota; Eurotiomycetes; ; Trichocomaceae; Talaromyces; Talaromyces marneffei
• CAZyme ID: PMAA_076970-t26_1-p1
• CAZy Family: GH63
• CAZyme Description: beta-galactosidase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1036	DS995901|CGC20	117732.15	5.4941

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TmarneffeiATCC18224	10194	441960	145	10049

• Gene Location: location=DS995901:63789-66959(+)

Full Sequence      

MRTMIFPQSLQDWNNLRVIHKGTLPPRAHFYSYVSNEKALTLDRQQSEYVSLNGTWKFHH
DESPLEAPDWESADPLSWDDIKVPGMWQLQGYSHPTYTNVNYPFHVNPPHVPLLNETGSY
WRQFVVSQAWDGQQIRIRFEGVDSAFHLWINGKLVGYSQGSRNPAEFDISNFLQPTGSAN
TIAVRVYEFCDGSYIERQDQWLLSGIFRDVGLLAFPPDSVIDFNAVPTLSEDLASGELTI
SVKTRGQDGVLQAKLYRPDGTILNESTFTSAEPCNIRVLGEDLELWSAENPILYTLLLSF
KGRTIPQRIGFRRIEQKNSNFLVNGKPIILYGMNRHEHHHLHGRAVPYESMRADLILMKK
HNINALRCAHQPNDPRLYEVCDELGLYVIAEADLETHGFDPVERNNIKDQHLMTEHEIQE
TSYKLAKKWTSDNPEWKDAYLDRAVELVERFKNFTCIIFWSLGNEAFYGQNHSSMYKWIK
ETDPTRLIHYEGDRDAITADLYSSMYWSVDTLKAHIREKTDKPLIQCEYGHAMGNGPGGL
KEYIHAYRSEELLQGGFIWEWCNHGLLKRDGDTSYYAYGGDYGDEPNDADFILDGMVFSD
HTPTPGLIEYKKVIEPVTVQLKGEQLEIKNHYDFSTLDHLTVYWHLVEETGSTEPILWQL
PAINPGQSKLVELPQGVKLGSKSTWLALNFCLRDATVWAAQGHEIAWAQIPLFDDEALSI
PPAPVLPGSILSVSEGLGRLYIVSNSFGSRFTYDLVRGNLSWSTDTGKIFNSGPQLGIYR
ALTQNDLGLEGPHLEWERFRIESTRMLVQSVTWSCNEDGTVTIDTKVRVAPTVLEWALEA
TLSYTITESSVNLHVKGDFSGTYPKYIPRLGVTVRLPRRYDASTWFGRGPGESYRDKKSA
ARFGTYTTSIREGLQTPYEWPQENGNRTDTRWTRIHSSLADTSYAASAKALASIPGIEVR
MDSPFNFSLRQYSISELDRAKHPHELSELVDESELNVDFAHHGIGTASCGPGPFQGHRLE
AGPFEFTVIFRLSDLA

Enzyme Prediction     

EC	3.2.1.23:12

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	40	903	5.7e-203	0.9720744680851063

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
236548	lacZ	0.0	11	1005	15	998	beta-galactosidase.
236673	ebgA	0.0	13	1026	4	993	cryptic beta-D-galactosidase subunit alpha; Reviewed
225789	LacZ	7.13e-145	47	905	10	808	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
397119	Glyco_hydro_2_C	7.69e-116	314	617	1	300	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
214988	Bgal_small_N	8.07e-71	748	1030	4	272	Beta galactosidase small chain. This domain comprises the small chain of dimeric beta-galactosidases EC:3.2.1.23. This domain is also found in single chain beta-galactosidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA16119.1|GH2	0.0	4	1036	1	1033
QYS98048.1|GH2	0.0	4	1033	1	1014
QKD57317.1|GH2	0.0	5	1034	1	1015
UPL02948.1|GH2	0.0	4	1034	1	1010
QMW42894.1|GH2	0.0	1	1033	4	1011

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3OB8_A	6.72e-219	2	1026	8	1025	Structure of the beta-galactosidase from Kluyveromyces lactis in complex with galactose [Kluyveromyces lactis],3OB8_B Structure of the beta-galactosidase from Kluyveromyces lactis in complex with galactose [Kluyveromyces lactis],3OB8_C Structure of the beta-galactosidase from Kluyveromyces lactis in complex with galactose [Kluyveromyces lactis],3OB8_D Structure of the beta-galactosidase from Kluyveromyces lactis in complex with galactose [Kluyveromyces lactis],3OBA_A Structure of the beta-galactosidase from Kluyveromyces lactis [Kluyveromyces lactis],3OBA_B Structure of the beta-galactosidase from Kluyveromyces lactis [Kluyveromyces lactis],3OBA_C Structure of the beta-galactosidase from Kluyveromyces lactis [Kluyveromyces lactis],3OBA_D Structure of the beta-galactosidase from Kluyveromyces lactis [Kluyveromyces lactis]
6S6Z_A	1.71e-182	12	1034	3	983	Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_B Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_C Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_D Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_E Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_F Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_G Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_H Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8]
6SD0_A	1.75e-182	12	1034	4	984	Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_B Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_C Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_D Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8]
3MUZ_1	2.54e-170	4	1030	34	1049	E.Coli (lacZ) beta-galactosidase (R599A) in complex with IPTG [Escherichia coli K-12],3MUZ_2 E.Coli (lacZ) beta-galactosidase (R599A) in complex with IPTG [Escherichia coli K-12],3MUZ_3 E.Coli (lacZ) beta-galactosidase (R599A) in complex with IPTG [Escherichia coli K-12],3MUZ_4 E.Coli (lacZ) beta-galactosidase (R599A) in complex with IPTG [Escherichia coli K-12],3MV0_1 E. COLI (lacZ) BETA-GALACTOSIDASE (R599A) IN COMPLEX WITH D-GALCTOPYRANOSYL-1-ONE [Escherichia coli K-12],3MV0_2 E. COLI (lacZ) BETA-GALACTOSIDASE (R599A) IN COMPLEX WITH D-GALCTOPYRANOSYL-1-ONE [Escherichia coli K-12],3MV0_3 E. COLI (lacZ) BETA-GALACTOSIDASE (R599A) IN COMPLEX WITH D-GALCTOPYRANOSYL-1-ONE [Escherichia coli K-12],3MV0_4 E. COLI (lacZ) BETA-GALACTOSIDASE (R599A) IN COMPLEX WITH D-GALCTOPYRANOSYL-1-ONE [Escherichia coli K-12],3MV1_1 E.Coli (lacZ) beta-galactosidase (R599A) in complex with Guanidinium [Escherichia coli K-12],3MV1_2 E.Coli (lacZ) beta-galactosidase (R599A) in complex with Guanidinium [Escherichia coli K-12],3MV1_3 E.Coli (lacZ) beta-galactosidase (R599A) in complex with Guanidinium [Escherichia coli K-12],3MV1_4 E.Coli (lacZ) beta-galactosidase (R599A) in complex with Guanidinium [Escherichia coli K-12]
3MUY_1	6.45e-170	11	1030	14	1020	Chain 1, Beta-D-galactosidase [Escherichia coli K-12],3MUY_2 Chain 2, Beta-D-galactosidase [Escherichia coli K-12],3MUY_3 Chain 3, Beta-D-galactosidase [Escherichia coli K-12],3MUY_4 Chain 4, Beta-D-galactosidase [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P00723|BGAL_KLULA	5.58e-218	5	1026	4	1018	Beta-galactosidase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=LAC4 PE=1 SV=2
sp|P06864|BGA2_ECOLI	2.09e-194	10	1026	1	993	Evolved beta-galactosidase subunit alpha OS=Escherichia coli (strain K12) OX=83333 GN=ebgA PE=1 SV=4
sp|Q56307|BGAL_THEMA	9.01e-182	12	1034	4	984	Beta-galactosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=lacZ PE=1 SV=2
sp|Q6LL68|BGAL_PHOPR	5.08e-175	11	1031	10	1026	Beta-galactosidase OS=Photobacterium profundum (strain SS9) OX=298386 GN=lacZ PE=3 SV=1
sp|A4W7D2|BGAL_ENT38	3.05e-172	11	1005	16	999	Beta-galactosidase OS=Enterobacter sp. (strain 638) OX=399742 GN=lacZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000062	0.000001

TMHMM  Annotations     

There is no transmembrane helices in PMAA_076970-t26_1-p1.