CAZyme Information: PMAA_074460-t26_1-p1

Basic Information

• Species: Talaromyces marneffei
• Lineage: Ascomycota; Eurotiomycetes; ; Trichocomaceae; Talaromyces; Talaromyces marneffei
• CAZyme ID: PMAA_074460-t26_1-p1
• CAZy Family: GH54|CBM42
• CAZyme Description: mannosidase MsdS

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
494	DS995900|CGC10	54381.61	4.3566

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TmarneffeiATCC18224	10194	441960	145	10049

• Gene Location: location=DS995900:3514519-3516160(+)

Full Sequence      

MRFSILSLAALTVASQAVESPDRANAVKQAFQIAWEGYYAHAFPHDQLHPVNNGYDDFYG
GWGASVVDALSTAAIMGHKDIVDQILDHIPNINFAYSNETTISLFETTIRYLGGLLAGYD
LLSGPAASLVSDKNKVDALLSQAQVLANTLSYAFETPSGVPYNNLLINKRSNDGSTTNGL
ATTGSLVMEWTHLADLTGNATYAKIAQKAESYLIRPQPPWAEPFPGLVGSTIDIATGEFM
DNYVSWNGGDDSFYEYLIKFFIYDPSRFSEYRDVWLAAAKSTLENLLSHPSPKPELTFVN
IWDNGTMIPTSQHLTGFIGGNFLLAGSVLGRNDLIEAGLAFTDSWHATYNSTATMIGPEV
FAWDETGVPAQQATFYKEAGFYITAADYVLRPEVLESYYYAYRITGETKYQDWAWDAFLA
INSTCHIGSGYSGIKDVNVAGGAGYDNEQESFFFAEVLKYSYMIHAEDADWQVKADGSNK
FVFNTEAHPFKIVG

Enzyme Prediction     

EC	3.2.1.113:12

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH47	30	492	2e-126	0.9977578475336323

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396217	Glyco_hydro_47	6.86e-177	30	492	1	453	Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2).
240427	PTZ00470	1.83e-108	23	492	72	518	glycoside hydrolase family 47 protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA18402.1|GH47	0.0	1	494	1	494
QKX61863.1|GH47	3.73e-225	1	480	1	483
QKX63978.1|GH47	1.09e-223	11	492	20	502
BCS05959.1|GH47	2.12e-211	6	492	8	510
BAA08634.1|GH47|3.2.1.113	1.73e-210	6	492	8	510

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2RI8_A	1.12e-207	23	492	5	473	Penicillium citrinum alpha-1,2-mannosidase complex with glycerol [Penicillium citrinum],2RI8_B Penicillium citrinum alpha-1,2-mannosidase complex with glycerol [Penicillium citrinum],2RI9_A Penicillium citrinum alpha-1,2-mannosidase in complex with a substrate analog [Penicillium citrinum],2RI9_B Penicillium citrinum alpha-1,2-mannosidase in complex with a substrate analog [Penicillium citrinum]
1KKT_A	2.82e-207	15	492	32	508	Structure of P. citrinum alpha 1,2-mannosidase reveals the basis for differences in specificity of the ER and Golgi Class I enzymes [Penicillium citrinum],1KKT_B Structure of P. citrinum alpha 1,2-mannosidase reveals the basis for differences in specificity of the ER and Golgi Class I enzymes [Penicillium citrinum],1KRE_A Structure Of P. Citrinum Alpha 1,2-Mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRE_B Structure Of P. Citrinum Alpha 1,2-Mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRF_A Structure Of P. Citrinum Alpha 1,2-mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRF_B Structure Of P. Citrinum Alpha 1,2-mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum]
1HCU_A	8.93e-167	20	492	12	492	Chain A, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei],1HCU_B Chain B, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei],1HCU_C Chain C, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei],1HCU_D Chain D, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei]
5KKB_A	1.81e-61	27	493	26	468	Structure of mouse Golgi alpha-1,2-mannosidase IA and Man9GlcNAc2-PA complex [Mus musculus],5KKB_B Structure of mouse Golgi alpha-1,2-mannosidase IA and Man9GlcNAc2-PA complex [Mus musculus]
1NXC_A	2.23e-61	27	493	24	466	Structure of mouse Golgi alpha-1,2-mannosidase IA reveals the molecular basis for substrate specificity among Class I enzymes (family 47 glycosidases) [Mus musculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0D076|MNS1B_ASPTN	3.88e-213	6	492	8	507	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mns1B PE=3 SV=1
sp|Q12563|MNS1B_ASPPH	3.07e-211	6	492	8	510	Mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus phoenicis OX=5063 GN=mns1B PE=2 SV=1
sp|A2QAS2|MNS1B_ASPNC	1.01e-209	22	492	41	510	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=mns1B PE=3 SV=1
sp|A1CP08|MNS1B_ASPCL	1.78e-207	10	492	18	508	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=mns1B PE=3 SV=1
sp|P31723|MAN12_PENCI	1.45e-206	15	492	32	508	Mannosyl-oligosaccharide alpha-1,2-mannosidase OS=Penicillium citrinum OX=5077 GN=MSDC PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000236	0.999735	CS pos: 17-18. Pr: 0.9748

TMHMM  Annotations     

There is no transmembrane helices in PMAA_074460-t26_1-p1.