CAZyme Information: PMAA_072420-t26_1-p1

Basic Information

• Species: Talaromyces marneffei
• Lineage: Ascomycota; Eurotiomycetes; ; Trichocomaceae; Talaromyces; Talaromyces marneffei
• CAZyme ID: PMAA_072420-t26_1-p1
• CAZy Family: GH49
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
412	DS995900|CGC5	47639.03	6.8650

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TmarneffeiATCC18224	10194	441960	145	10049

• Gene Location: location=DS995900:2940409-2941710(-)

Full Sequence      

MSNVAMNPQTRLLFSFLLKPRRILLWLSIGIVVFIVQPIFSLHTNATLRKIDDNDTRPRF
WYRSHFRNNPDFEYEHRISNALQGIERDVLAGNGGNTLAEERIWQIARDEEQRGDDSKAL
ERQNRVWTYSLMTDEKALDFIDNVLSTVPEIAQIYHSYPYYVLRTDLLRYLLLWYYGGFY
ADIDVFPARPIKGCPDLRPLFFSNNQELGNISLVVGIELDEPYVSERGMREWHWTRRYGF
LQYTMYAPRRFSPVLREIVTRVMAHTKQHNERLASYFLGYSESTILGISGPDVVTDAVLD
VLSTTLPPTHRLMNVSMEKDAGIDPLPVSHVTGETERRVTWAPFHRINEPLCVDDVEAVH
EGSLGGICVLPVNAWGNGQRHSGSEGFESSRACVNHRFRGSWKKGWWQTHFG

Enzyme Prediction     

No EC number prediction in PMAA_072420-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	122	193	1.7e-18	0.8111111111111111

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398274	Gly_transf_sug	2.54e-06	118	191	9	83	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
226297	OCH1	2.16e-04	102	261	85	242	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA18206.1|GT32	1.55e-310	6	412	1	407
QKX54668.1|GT32	3.16e-177	17	412	10	403
CAP98643.1|GT32	8.61e-150	58	412	61	421
QMW37982.1|GT32	5.33e-144	53	412	54	413
UCK58385.1|GT32	5.33e-144	53	412	54	413

PDB Hits     

PMAA_072420-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5A4E3|OCH1_CANAL	8.14e-19	121	403	128	376	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P31755|OCH1_YEAST	2.67e-18	101	404	98	471	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|Q9UTR6|OCH1_SCHPO	4.38e-17	103	403	146	394	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|P47124|HOC1_YEAST	3.71e-15	103	356	134	353	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|O14084|IMT1_SCHPO	6.99e-08	127	205	98	181	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.968267	0.031736

TMHMM  Annotations     

Start	End
23	40