CAZyme Information: PMAA_066320-t26_1-p1

Basic Information

• Species: Talaromyces marneffei
• Lineage: Ascomycota; Eurotiomycetes; ; Trichocomaceae; Talaromyces; Talaromyces marneffei
• CAZyme ID: PMAA_066320-t26_1-p1
• CAZy Family: GH35
• CAZyme Description: UDP-glucose,sterol transferase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1197		131000.81	6.4340

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TmarneffeiATCC18224	10194	441960	145	10049

• Gene Location: location=DS995900:1204717-1208651(-)

Full Sequence      

MALSRESSGNTTTATDDNYDMSHIPTQEDFSVGEGVPEPAYSHVYGRMDLANKGLNTQAS
ITSNGRVDIDIAEPTSRLRSLFKLPSFGSRSRSSILSAPTSAPIPPSLDRSQDQKPPPLN
IVIQIIGSRGDVQPFIALGRVLKYSHGHRVRLATHASFQGFVEENGLEFFSIGGDPVELM
AFMVKNPGLMPGFDALRNGDIHRRRVDIAAIISGCWRSCFEAGDGTGVPVSDRTVDLNHF
KAGRTPFVADAIIANPPSFAHVHCAEKLGIPLHMMFTMPWSPTQAFPHPLASIHRSNADA
GVTNYASYAIVEMMTWQGLGDIINRFREKSLGLAPISIMWAPSMVSRLKIPHTYCWSPAL
IPKPNDWGSYIDIAGFYFLSLASNYTPPDDLEAFLSAGPPPIYIGFGSIVVDDPNRMTQL
IFDAIRLTGRRAIVSKGWGGLGTEELSVPDGIFMIGNCPHDWLFRHVSCVVHHGGAGTTA
AGIAAGRSTVIVPFFGDQPFWGAMVAKAGAGPQPIPYKELTAEKLADAIKFALEPAMSEK
AASLAAIIETEHGADDGAISFQNHLKVDRMRCSLDPDRTAVFRIKRTQIRLSALAFALLN
TEGKLGLDDVKLYRSQEYMTEPDPTDPVIGGGVAMLDSIEGFLMGFADLSMDVKRSLNTR
ISRSCSRSSTSLNRQAGSQSRTSSPTAALRAKTLSDVDSLLKPPTETSSISTTGSASTSL
AGDQVTDGSTENSTLVESQTVDSMTKPTRTRKHARTINDIRDLDVDGIVSAGKSAAKVVN
LGLRAPASFTMAVAKGFHNMPLLYGDDTVREQSKVTGLKSGLKAAGKEFGYGFLDGISGL
ATQPVQGARKEGAVGAIKGFGKGIGGLILKPAAAVWSLTGYTMSGLYQEIQKRFGESVEN
YIMASRCAQGLTDLSTCTNEEKEDILTNWAFFETDVVAKRNERLNRYKVDRDMKRIRTRI
LDENTKDTAKLQGQDTESVKAAERANGREPLHHLFRGRASSSPPPRQTILDLVLPDEYED
AIRDSVLATSQGNNTEDEMIERALRASMTELRNAEVAGEEEDRAYELAVEASIREAARVI
EEKKREHEKGSLASKDEESKHYVDQLRSHSPPNSVDQSDQEQPRRPPPALPPRSPMPIPT
DHDTELQHALNESKRDHDNRLRREQREKDEMDIIIEYIKRQSLAEAEQQRREQKQEQ

Enzyme Prediction     

EC	2.4.1.173:23	2.4.1.-:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	237	558	5.6e-58	0.7591623036649214

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	2.44e-70	119	564	1	404	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	2.34e-29	121	558	4	392	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
397255	Glyco_transf_28	2.58e-17	121	287	1	139	Glycosyltransferase family 28 N-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). This N-terminal domain contains the acceptor binding site and likely membrane association site. This family also contains a large number of proteins that probably have quite distinct activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA15144.1|GT1	0.0	1	1197	1	1197
QKX62129.1|GT1	0.0	20	1190	18	1174
ATZ49754.1|GT1	0.0	37	1185	81	1286
CCD33816.1|GT1	0.0	37	1185	81	1286
APA09867.1|GT1	0.0	37	1058	81	1155

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XVM_A	6.35e-77	126	603	27	474	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C],5XVM_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C]
5GL5_A	1.09e-76	126	603	47	494	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C],5GL5_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C]
3H4I_A	2.38e-31	119	551	1	368	Chimeric Glycosyltransferase for the generation of novel natural products [Amycolatopsis orientalis],3H4T_A Chimeric Glycosyltransferase for the generation of novel natural products - GtfAH1 in complex with UDP-2F-Glc [Amycolatopsis orientalis]
1IIR_A	2.32e-30	265	554	113	388	Crystal Structure of UDP-glucosyltransferase GtfB [Amycolatopsis orientalis]
1RRV_A	2.72e-23	119	554	1	389	X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis],1RRV_B X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9XIG1|U80B1_ARATH	1.83e-126	117	565	154	574	Sterol 3-beta-glucosyltransferase UGT80B1 OS=Arabidopsis thaliana OX=3702 GN=UGT80B1 PE=1 SV=1
sp|Q9M8Z7|U80A2_ARATH	6.86e-126	107	576	181	620	Sterol 3-beta-glucosyltransferase UGT80A2 OS=Arabidopsis thaliana OX=3702 GN=UGT80A2 PE=1 SV=1
sp|Q2U0C3|ATG26_ASPOR	8.31e-72	119	555	892	1299	Sterol 3-beta-glucosyltransferase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=atg26 PE=3 SV=2
sp|A7A179|ATG26_YEAS7	1.15e-71	126	603	747	1194	Sterol 3-beta-glucosyltransferase OS=Saccharomyces cerevisiae (strain YJM789) OX=307796 GN=ATG26 PE=3 SV=1
sp|Q06321|ATG26_YEAST	3.70e-71	126	603	747	1194	Sterol 3-beta-glucosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ATG26 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000055	0.000008

TMHMM  Annotations     

There is no transmembrane helices in PMAA_066320-t26_1-p1.