CAZyme Information: PMAA_064660-t26_1-p1

Basic Information

• Species: Talaromyces marneffei
• Lineage: Ascomycota; Eurotiomycetes; ; Trichocomaceae; Talaromyces; Talaromyces marneffei
• CAZyme ID: PMAA_064660-t26_1-p1
• CAZy Family: GH31
• CAZyme Description: beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
953		106661.78	4.9727

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TmarneffeiATCC18224	10194	441960	145	10049

• Gene Location: location=DS995900:780889-784028(+)

Full Sequence      

MLMRKKILLAAGFPLLTLAQRVIDLSGDNWTVKNEECNLSAPASLPSQVHLDLYAAGVIH
TPEQMKLTFAGSPGRTGHIRVIQSRDCMLNDASASWIVFNGLDTFATIELCGQLVGTANN
QFRQWQFDVSGALKSCKGDPVISIHFRSAPEIANAIANEPGQETWPDGIQGLFEFDNRWF
IRKEQSDFGWDWGPAFSPTGPWQPAYLVQFKPNDGVYVLNTDIDIHREGQVNWLPPDQTR
PWVVNASIVYLGSLPKGASLTVEIKDAQNQTTIASGSLTNVTTSGNSISGITTVGADVPK
LWWPTSMGDQNLYYITINVVNNNGKTLATITKRTGFRTIVLNQTNITHAQLALGIAPGAN
WHFEINGHEFYAKGSNFIPPDAFWPRVTEDRMRRLFNSIVKGNQNMLRVWASGAYLPNFI
YDIADEVGVLLWSEFQFGDALYPVDQVFLDNVAAEVAYNVRRVNHHPSLALWAGGNELES
LELLQVYENYPEEYARYVGEYEKLFISTIFPLVYDNTHSISYTPTSTGNGYTNIDFSLAV
PMVERYQNVTPGEYYGDSDYYNYNSAEAFDMSHYPVNRFANEFGFHSMPSLQTWRQAVYD
EDDLQFNSSVILHRNHHYPPGGLSLNTTLSAKGMGEMTIAVERYYPIPSKTDPIANFSAW
CLATQRFQADMYKSQIQFYRRGSGHPERQLGSLYWQLEDIWQAPTWAGIEYDGRWKVLHY
VAKNIFEPVIVAPYWNSTTGQLNVTVTSDLWESVSGTVSMTWYDLSGKPLEKNAGIPSSV
AFDVGPLNITDILITNINDLSISDLKDAVLILSLSATGHLPNSNVTTRFSHENFFTPVFT
NEAKLVDPGLKLSYDNSTGKFTVEATKAVSLYTWLDYPSGLVGYFDENSFVLVPGQPKEV
GFTAQQGSLSEDVVRHVTVQSIWDQAEGLKSTVVRVREKGLRPLRDARNQPDA

Enzyme Prediction     

EC	3.2.1.25:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	20	774	9.1e-74	0.6715425531914894

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225789	LacZ	2.70e-43	96	733	83	636	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
407625	Ig_mannosidase	2.97e-16	847	924	1	78	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.
236673	ebgA	2.03e-10	206	477	202	449	cryptic beta-D-galactosidase subunit alpha; Reviewed
395572	Glyco_hydro_2	3.02e-08	217	337	6	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
407658	Mannosidase_ig	1.16e-07	740	814	1	71	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA14982.1|GH2	0.0	1	953	1	958
QKX59399.1|GH2	0.0	6	926	5	922
QMW39414.1|GH2	0.0	8	941	10	943
QMW27343.1|GH2	0.0	8	941	10	943
BAE57065.1|GH2	0.0	8	925	10	910

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4CVU_A	0.0	24	924	32	938	Structure of Fungal beta-mannosidase from Glycoside Hydrolase Family 2 of Trichoderma harzianum [Trichoderma harzianum],4UOJ_A Chain A, BETA-MANNOSIDASE GH2 [Trichoderma harzianum],4UOJ_B Chain B, BETA-MANNOSIDASE GH2 [Trichoderma harzianum]
6DDT_A	3.20e-98	25	893	14	836	mouse beta-mannosidase (MANBA) [Mus musculus],6DDU_A mouse beta-mannosidase bound to beta-D-mannose (MANBA) [Mus musculus]
6BYE_A	1.26e-73	42	905	34	835	Crystal structure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306],6BYE_B Crystal structure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306]
6BYC_A	1.28e-73	42	905	34	835	Crystal structure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
6BYI_A	8.02e-73	42	905	32	833	Crystal structure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYI_B Crystal structure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WMS9|MANBA_ASPFU	0.0	14	925	16	922	Beta-mannosidase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=mndA PE=3 SV=1
sp|O74168|MANBA_ASPAC	0.0	13	928	17	936	Beta-mannosidase A OS=Aspergillus aculeatus OX=5053 GN=mndA PE=1 SV=1
sp|Q0CI48|MANBA_ASPTN	0.0	21	925	24	928	Beta-mannosidase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mndA PE=3 SV=2
sp|Q2UN00|MANBA_ASPOR	0.0	8	925	10	910	Beta-mannosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=mndA PE=3 SV=1
sp|A1CTM5|MANBA_ASPCL	0.0	8	925	11	928	Beta-mannosidase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=mndA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.015751	0.984235	CS pos: 19-20. Pr: 0.9391

TMHMM  Annotations     

There is no transmembrane helices in PMAA_064660-t26_1-p1.