CAZyme Information: PMAA_062560-t26_1-p1

Basic Information

• Species: Talaromyces marneffei
• Lineage: Ascomycota; Eurotiomycetes; ; Trichocomaceae; Talaromyces; Talaromyces marneffei
• CAZyme ID: PMAA_062560-t26_1-p1
• CAZy Family: GH3
• CAZyme Description: extracellular exo-polygalacturonase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
421	DS995900|CGC14	43787.58	4.5171

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TmarneffeiATCC18224	10194	441960	145	10049

• Gene Location: location=DS995900:218226-219610(-)

Full Sequence      

MFLLDGCFIFHQTDGSGMSGLKCKHDLLQCAHIVSSTALPPSKTIEKRAICTPGGYGNAS
KDDTPAIASAIATCGKGGSIVIPSGTTYNLRSTLDFAGCFGCELQLKGTLKVSNDYQCWS
DYKAIILVSDITGATITSTTGAGVIDGNGQDAYDAFAADSLLSRPTLVYIIGSSDITMSG
FRVKDPPNVFFSNTGSSRNIEYASLTMIASSKSTNAPKNTDGFDVGTSTFTTIHNVYVSN
QDDCITFKPGANYATVDNVTCAGTNHGVSIGSLGESGDNTVTNIYVTNLSASGCSKAAGI
KLYASGPDYGTATVHNVTYQGVTVDDCDYGLQIQSCYNSNSSYCAEYPTTASLTDVYFKD
FSGTTSGKHGSVVANLDCSADMTCDVYVENFSIKPPSGTAEVLCANFDGSPGVTCTPGAS
G

Enzyme Prediction     

EC	3.2.1.-:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	68	408	3.6e-65	0.9753846153846154

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395231	Glyco_hydro_28	8.15e-36	79	393	8	303	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
215540	PLN03010	1.23e-28	54	409	53	391	polygalacturonase
178580	PLN03003	5.38e-26	54	415	30	388	Probable polygalacturonase At3g15720
215120	PLN02188	7.21e-25	54	406	43	389	polygalacturonase/glycoside hydrolase family protein
177865	PLN02218	4.49e-24	19	406	43	419	polygalacturonase ADPG

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA14768.1|GH28	2.01e-153	207	421	1	215
CCD34308.1|GH28	6.67e-147	44	421	33	412
ATZ46537.1|GH28	6.67e-147	44	421	33	412
QKX54219.1|GH28	1.98e-144	28	421	15	405
CAC07733.1|GH28|3.2.1.-	1.17e-143	41	421	27	406

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4C2L_A	2.18e-145	41	421	9	388	Crystal structure of endo-xylogalacturonan hydrolase from Aspergillus tubingensis [Aspergillus tubingensis]
6KVE_A	2.74e-26	45	366	5	301	Chain A, Endo-polygalacturonase [Evansstolkia leycettana]
6KVH_A	3.76e-26	45	366	5	301	Chain A, endo-polygalacturonase [Evansstolkia leycettana]
1NHC_A	1.17e-25	79	364	25	291	Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_B Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_C Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_D Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_E Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_F Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger]
7E56_A	7.77e-25	79	366	25	293	Chain A, Endo-polygalacturonase [Evansstolkia leycettana]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UUZ2|XGHA_ASPTU	2.08e-144	41	421	27	406	Endo-xylogalacturonan hydrolase A OS=Aspergillus tubingensis OX=5068 GN=xghA PE=1 SV=1
sp|A2QK83|XGHA_ASPNC	2.39e-143	26	421	6	406	Probable endo-xylogalacturonan hydrolase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=xghA PE=3 SV=1
sp|B8NPS8|XGHA_ASPFN	1.57e-141	35	421	21	406	Probable endo-xylogalacturonan hydrolase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=xghA PE=3 SV=1
sp|Q2UBD8|XGHA_ASPOR	4.47e-141	35	421	21	406	Probable endo-xylogalacturonan hydrolase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=xghA PE=3 SV=1
sp|A1DBT5|XGHA_NEOFI	2.21e-136	41	421	27	406	Probable endo-xylogalacturonan hydrolase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=xghA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000007	0.000011

TMHMM  Annotations     

There is no transmembrane helices in PMAA_062560-t26_1-p1.