CAZyme Information: PMAA_061300-t26_1-p1

Basic Information

• Species: Talaromyces marneffei
• Lineage: Ascomycota; Eurotiomycetes; ; Trichocomaceae; Talaromyces; Talaromyces marneffei
• CAZyme ID: PMAA_061300-t26_1-p1
• CAZy Family: GH3
• CAZyme Description: endoglucanase-5 precursor, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
338	DS995903|CGC12	34087.43	4.0427

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TmarneffeiATCC18224	10194	441960	145	10049

• Gene Location: location=DS995903:3059572-3060691(+)

Full Sequence      

MKAFYLSLWALAGSASAYLATTTRYYDGQEGACGCGSSSGLSSWQLGISNGVYTAAGSQA
LFDTNDSSWCGGGCGKCYNLTSTGTSACNGCGEGGVAGESIIVMVTNLCPYNGNEVWCPS
VGAKNNYGYSYHFDIMAESEVFGDNVVVNFEPVACPGQAALDWGTCVCHGQTDTDTTPAG
MAAAAAAESAGTVATSSSSSSSSTSTVKTSTTLVAVPTSPVKEVASSSTSSTSTVKSIPT
VVAESSPAAVVEPTSTAISTPQGAATTSTTSVTQYTTVTEIATVWVTPNPSATTCSSSAV
QTLYGQCGGINWTGATTCVSGSTCKVQNPYYYQCVSSA

Enzyme Prediction     

EC	3.2.1.4:3	3.2.1.4:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM1	304	331	3.6e-16	0.9310344827586207

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
409015	DPBB_GH45_endoglucanase	3.37e-26	20	155	7	149	double-psi beta-barrel fold of glycoside hydrolase family 45 endoglucanase EG27II and similar proteins. This group is made up of endoglucanases from mollusks similar to Ampullaria crossean endoglucanase EG27II, a glycoside hydrolase family 45 (GH45) subfamily B protein. Endoglucanases (EC 3.2.1.4) catalyze the endohydrolysis of (1-4)-beta-D-glucosidic linkages in cellulose, lichenin, and cereal beta-D-glucans. Animal cellulases, such as endoglucanase EG27II, have great potential for industrial applications such as bioethanol production. GH45 endoglucanases from mollusks adopt a double-psi beta-barrel (DPBB) fold.
395595	CBM_1	2.03e-12	303	331	1	29	Fungal cellulose binding domain.
197593	fCBD	2.75e-10	302	335	1	34	Fungal-type cellulose-binding domain. Small four-cysteine cellulose-binding domain of fungi
409008	DPBB_EXP_N-like	2.18e-05	53	135	33	92	N-terminal double-psi beta-barrel fold domain of the expansin family and similar domains. The plant expansin family consists of four subfamilies, alpha-expansin (EXPA), beta-expansin (EXPB), expansin-like A (EXLA), and expansin-like B (EXLB). EXPA and EXPB display cell wall loosening activity and are involved in cell expansion and other developmental events during which cell wall modification occurs. EXPA proteins function more efficiently on dicotyledonous cell walls, whereas EXPB proteins exhibit specificity for the cell walls of monocotyledons. Expansins also affect environmental stress responses. Expansin family proteins contain an N-terminal domain (D1) homologous to the catalytic domain of glycoside hydrolase family 45 (GH45) proteins but with no hydrolytic activity, and a C-terminal domain (D2) homologous to group-2 grass pollen allergens. This family also includes GH45 endoglucanases from mollusks. This model represents the N-terminal domain of expansins and similar proteins, which adopts a double-psi beta-barrel (DPBB) fold.
409011	DPBB_EXPA_N	3.01e-05	51	118	34	95	N-terminal double-psi beta-barrel fold domain of the alpha-expansin subfamily. Alpha-expansins (EXPA, expansin-A) have cell wall loosening activity and are involved in cell expansion and other developmental events during which cell wall modification occurs. They also affect environmental stress responses. Arabidopsis thaliana EXPA1 is a cell wall modifying enzyme that controls the divisions marking lateral root initiation. Nicotiana tabacum EXPA4 positively regulates abiotic stress tolerance, and negatively regulates pathogen resistance. Wheat TaEXPA2 is involved in conferring cadmium tolerance. Alpha-expansins belong to the expansin family of proteins that contain an N-terminal domain (D1) homologous to the catalytic domain of glycoside hydrolase family 45 (GH45) proteins but with no hydrolytic activity, and a C-terminal domain (D2) homologous to group-2 grass pollen allergens. This model represents the N-terminal domain of alpha-expansins, which adopts a double-psi beta-barrel (DPBB) fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA19871.1|CBM1|GH45	2.44e-207	1	338	1	338
QGA20713.1|CBM1|GH45	3.64e-106	1	335	1	251
QKX54271.1|CBM1|GH45	2.67e-98	1	338	1	281
QYT05581.1|CBM1|GH45	2.06e-96	1	336	1	266
UKZ52485.1|CBM1|GH45	6.72e-96	10	336	10	239

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XBU_A	5.71e-27	20	169	25	181	Crystal structure of GH45 endoglucanase EG27II in apo-form [Ampullaria crossean],5XBX_A Crystal structure of GH45 endoglucanase EG27II in complex with cellobiose [Ampullaria crossean],5XC4_A Crystal structure of GH45 endoglucanase EG27II at pH4.0, in complex with cellobiose [Ampullaria crossean],5XC8_A Crystal structure of GH45 endoglucanase EG27II at pH5.5, in complex with cellobiose [Ampullaria crossean],5XC9_A Crystal structure of GH45 endoglucanase EG27II at pH8.0, in complex with cellobiose [Ampullaria crossean]
5XCA_A	8.14e-26	20	169	25	181	Crystal structure of GH45 endoglucanase EG27II D137A mutant in complex with cellobiose [Ampullaria crossean]
1WC2_A	1.80e-22	20	171	17	181	Chain A, ENDOGLUCANASE [Mytilus edulis]
1CBH_A	6.63e-10	301	335	2	36	Chain A, C-TERMINAL DOMAIN OF CELLOBIOHYDROLASE I [Trichoderma reesei],2CBH_A Chain A, C-TERMINAL DOMAIN OF CELLOBIOHYDROLASE I [Trichoderma reesei],2MWJ_A Chain A, Exoglucanase 1 [Trichoderma reesei],2MWK_A Chain A, Exoglucanase 1 [Trichoderma reesei],5X34_A Chain A, Exoglucanase 1 [Trichoderma reesei],5X35_A Chain A, Exoglucanase 1 [Trichoderma reesei],5X36_A Chain A, Exoglucanase 1 [Trichoderma reesei],5X37_A Chain A, Exoglucanase 1 [Trichoderma reesei],5X38_A Chain A, Exoglucanase 1 [Trichoderma reesei]
5X39_A	1.71e-09	304	335	5	36	Chain A, Exoglucanase 1 [Trichoderma reesei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P43317|GUN5_HYPJE	2.15e-95	11	335	11	241	Endoglucanase-5 OS=Hypocrea jecorina OX=51453 GN=egl5 PE=3 SV=1
sp|P82186|GUN_MYTED	9.25e-22	20	171	17	181	Endoglucanase OS=Mytilus edulis OX=6550 PE=1 SV=1
sp|Q9P8P3|GUX1_TRIHA	4.10e-10	290	335	460	505	Exoglucanase 1 OS=Trichoderma harzianum OX=5544 GN=cbh1 PE=1 SV=1
sp|Q66NB7|EG5A_PHACH	5.74e-10	299	338	17	56	Manganese dependent endoglucanase Eg5A OS=Phanerodontia chrysosporium OX=2822231 GN=Eg5A PE=1 SV=2
sp|Q0CFP1|CBHC_ASPTN	1.65e-09	299	335	18	54	Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=cbhC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000267	0.999707	CS pos: 17-18. Pr: 0.9788

TMHMM  Annotations     

There is no transmembrane helices in PMAA_061300-t26_1-p1.