CAZyme Information: PMAA_054770-t26_1-p1

Basic Information

• Species: Talaromyces marneffei
• Lineage: Ascomycota; Eurotiomycetes; ; Trichocomaceae; Talaromyces; Talaromyces marneffei
• CAZyme ID: PMAA_054770-t26_1-p1
• CAZy Family: GH18
• CAZyme Description: alpha methylacyl-CoA racemase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1068		118934.06	6.4842

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TmarneffeiATCC18224	10194	441960	145	10049

• Gene Location: location=DS995903:1266863-1271033(+)

Full Sequence      

MSSKQVPAIPTLEEKHSGIPSRLYEKAHLAKSLILDIQTKQQNDRKRGVAIPAGVEKNTF
FRAIDELSEQLGKENVELNDQPLKDGWYMEHPNTHDAMHVLDEEELVASAVVYPGSTEEV
QKIVLWANKYKVPIFPISIGRNLGYGGAAPRVRGSVVIDLGRRMNKILDINPVDHTCLVE
PGVTFYALYEEIQRRGYKHLWIDCPDLGGGSVLGNTLDRGIGYTVYGDHWACHSGLEVVL
PTGELIRTGMGAMANSSSWQIFPYGYGPMADGLFSQSNYGIVTKLGMTLMPNPGGYESYL
YTFPNELDLAPLVDIIRPLRIGNILENVAQLRHVVQAIAYSGKPRNSYFKGEGQMSDELV
REIARKELNYGEFTWLYYGMSYGPKEIRQYKLDIIHKEFSKIPGARRIDPATLPKTDYFW
SRDNIAAGIPDFEELRWVNWYPNGGHIAFSPVSPVRGADATELWRIARSRAAEFGHDIFP
AFCVGLREMHLIVECVFDRDDPDSRKKALACMRAMIDEAASKGYGEYRTHLVLMDQIAKT
YDFNDHALMKFNERIKDTLDPNGILAPGKSGVWPARYRGRGWEMSGLGDQSEGSGVARDS
ATRLAIEKSSELKLEMSRNPNMWGPQPAAPTLWGPIVILQAHFTRNFAKQTNTEANTILL
LSTQILYSYTNSSKYYRQRQIKIAQDSNIIERADIIKVEHPERGDDTRAWGPPFAEYKDG
REGPGESAYYLSVNRNKKSLGLSFAHPEGVEILHELAKNCDVLVENYLPGSLKKYNMDYE
SIRKLNPRLIYASITGYGQTGPYSNRPGFDVMVEAEFGLMHLTGSRDGPPVKVGVAVTDL
TTGLYACNSIMAALLARANTGEGQHLDVCLSDVQTATLANMAESVLISGKPDSGRWGTAH
PSVVPYQGFKTSDGDIFLGGANDRLFGILCEKLGKSEWSKDPKYVTNNERVRNRKELEDL
IEAETTKRTTQEWLEILEGSGLPYAAVNDVLGTLNHEHTKARGMVQEIDHPSCGPIKVLS
PPVKYSNADPSIRSPPPLLGEHTDEILESVVGLGKERIQNLKAKGVVA

Enzyme Prediction     

EC	1.1.3.38:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA4	50	582	1.2e-223	0.9923371647509579

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224717	CaiB	1.13e-134	693	1067	34	396	Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases [Lipid transport and metabolism].
396872	CoA_transf_3	2.50e-133	693	1043	27	367	CoA-transferase family III. CoA-transferases are found in organisms from all lines of descent. Most of these enzymes belong to two well-known enzyme families, but recent work on unusual biochemical pathways of anaerobic bacteria has revealed the existence of a third family of CoA-transferases. The members of this enzyme family differ in sequence and reaction mechanism from CoA-transferases of the other families. Currently known enzymes of the new family are a formyl-CoA: oxalate CoA-transferase, a succinyl-CoA: (R)-benzylsuccinate CoA-transferase, an (E)-cinnamoyl-CoA: (R)-phenyllactate CoA-transferase, and a butyrobetainyl-CoA: (R)-carnitine CoA-transferase. In addition, a large number of proteins of unknown or differently annotated function from Bacteria, Archaea and Eukarya apparently belong to this enzyme family. Properties and reaction mechanisms of the CoA-transferases of family III are described and compared to those of the previously known CoA-transferases.
183132	PRK11430	9.98e-74	693	1046	36	375	putative CoA-transferase; Provisional
180055	PRK05398	7.58e-69	693	1067	31	416	formyl-coenzyme A transferase; Provisional
223354	GlcD	4.17e-33	107	570	31	455	FAD/FMN-containing dehydrogenase [Energy production and conversion].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKX53460.1|AA4	0.0	1	1068	1	1038
QGA20504.1|AA4	0.0	1	604	1	604
CAP97133.1|AA4	6.83e-314	1	602	1	601
AEO67281.1|AA4	1.92e-310	9	596	11	599
BCS28228.1|AA4	9.58e-309	1	602	1	601

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1E8F_A	7.62e-178	47	584	8	560	Structure Of The H61t Mutant Of The Flavoenzyme Vanillyl- Alcohol Oxidase In The Apo Form [Penicillium simplicissimum],1E8F_B Structure Of The H61t Mutant Of The Flavoenzyme Vanillyl- Alcohol Oxidase In The Apo Form [Penicillium simplicissimum],1E8G_A STRUCTURE OF THE H61T DOUBLE MUTANT OF VANILLYL-ALCOHOL OXIDASE IN COMPLEX WITH FLUORO-CRESOL [Penicillium simplicissimum],1E8G_B STRUCTURE OF THE H61T DOUBLE MUTANT OF VANILLYL-ALCOHOL OXIDASE IN COMPLEX WITH FLUORO-CRESOL [Penicillium simplicissimum],1E8H_A Structure Of The H61t Mutant Of The Flavoenzyme Vanillyl- Alcohol Oxidase In The Apo Form Complexed By Adp [Penicillium simplicissimum],1E8H_B Structure Of The H61t Mutant Of The Flavoenzyme Vanillyl- Alcohol Oxidase In The Apo Form Complexed By Adp [Penicillium simplicissimum]
1W1K_A	5.98e-177	47	584	8	560	STRUCTURE OF THE OCTAMERIC FLAVOENZYME VANILLYL-ALCOHOL OXIDASE: Ile238Thr Mutant [Penicillium simplicissimum],1W1K_B STRUCTURE OF THE OCTAMERIC FLAVOENZYME VANILLYL-ALCOHOL OXIDASE: Ile238Thr Mutant [Penicillium simplicissimum]
1DZN_A	8.42e-177	47	584	8	560	Asp170Ser mutant of vanillyl-alcohol oxidase [Penicillium simplicissimum],1DZN_B Asp170Ser mutant of vanillyl-alcohol oxidase [Penicillium simplicissimum]
1E0Y_A	1.19e-176	47	584	8	560	Structure of the D170S/T457E double mutant of vanillyl-alcohol oxidase [Penicillium simplicissimum],1E0Y_B Structure of the D170S/T457E double mutant of vanillyl-alcohol oxidase [Penicillium simplicissimum]
1AHU_A	1.67e-176	47	584	8	560	Structure Of The Octameric Flavoenzyme Vanillyl-Alcohol Oxidase In Complex With P-Cresol [Penicillium simplicissimum],1AHU_B Structure Of The Octameric Flavoenzyme Vanillyl-Alcohol Oxidase In Complex With P-Cresol [Penicillium simplicissimum],1AHV_A Structure Of The Octameric Flavoenzyme Vanillyl-Alcohol Oxidase In Complex With 2-Nitro-P-Cresol [Penicillium simplicissimum],1AHV_B Structure Of The Octameric Flavoenzyme Vanillyl-Alcohol Oxidase In Complex With 2-Nitro-P-Cresol [Penicillium simplicissimum],1AHZ_A Structure Of The Octameric Flavoenzyme Vanillyl-Alcohol Oxidase In Complex With 4-(1-Heptenyl)phenol [Penicillium simplicissimum],1AHZ_B Structure Of The Octameric Flavoenzyme Vanillyl-Alcohol Oxidase In Complex With 4-(1-Heptenyl)phenol [Penicillium simplicissimum],1VAO_A Structure Of The Octameric Flavoenzyme Vanillyl-alcohol Oxidase [Penicillium simplicissimum],1VAO_B Structure Of The Octameric Flavoenzyme Vanillyl-alcohol Oxidase [Penicillium simplicissimum],2VAO_A Structure Of The Octameric Flavoenzyme Vanillyl-Alcohol Oxidase In Complex With Isoeugenol [Penicillium simplicissimum],2VAO_B Structure Of The Octameric Flavoenzyme Vanillyl-Alcohol Oxidase In Complex With Isoeugenol [Penicillium simplicissimum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P56216|VAOX_PENSI	8.61e-176	47	584	8	560	Vanillyl-alcohol oxidase OS=Penicillium simplicissimum OX=69488 GN=VAOA PE=1 SV=1
sp|Q7TNE1|SUCHY_MOUSE	1.05e-108	693	1067	65	430	Succinate--hydroxymethylglutarate CoA-transferase OS=Mus musculus OX=10090 GN=Sugct PE=1 SV=2
sp|Q68FU4|SUCHY_RAT	2.94e-107	693	1067	65	430	Succinate--hydroxymethylglutarate CoA-transferase OS=Rattus norvegicus OX=10116 GN=Sugct PE=2 SV=1
sp|Q9HAC7|SUCHY_HUMAN	2.97e-105	693	1067	74	439	Succinate--hydroxymethylglutarate CoA-transferase OS=Homo sapiens OX=9606 GN=SUGCT PE=1 SV=2
sp|P09788|DH4C_PSEPU	4.19e-104	46	572	4	515	4-cresol dehydrogenase [hydroxylating] flavoprotein subunit OS=Pseudomonas putida OX=303 GN=pchF PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000054	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PMAA_054770-t26_1-p1.