CAZyme Information: PMAA_050710-t26_1-p1

Basic Information

• Species: Talaromyces marneffei
• Lineage: Ascomycota; Eurotiomycetes; ; Trichocomaceae; Talaromyces; Talaromyces marneffei
• CAZyme ID: PMAA_050710-t26_1-p1
• CAZy Family: PL35
• CAZyme Description: hyaluronan synthase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
596		67805.20	6.3819

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TmarneffeiATCC18224	10194	441960	145	10049

• Gene Location: location=DS995903:140064-142045(+)

Full Sequence      

MILANDPQSRLPSFHCRGPYVSQVRQFFNFLGCLFIIPVYYFITGYTKFPLTLDLMISIF
VAEYNRWANENRRSRLHETPPSNPTCDVEKAVLSSQKSPPGEVTRCMAAIVGYREDPDLF
YRALESYKATEGLDFTLVGVDGDQAADMDMVRVFQMVYPKESAVIHLDEPLGEIAMRTYS
KLVDPDMCSPEDIEYCNELTIAHCCQLVREILREHDIQLDKTQPGGITKLCIYEPHMHKK
AIMFTSFIFSIVISEILNIEFMWSSDSDTIVLPDSLQKTIATVAGDENAGGASSGLIVHN
EHDTLWTKLGSAVYWCELYLTRSTSASSGTSDCQSGPSTVFRISALPGVLYCWYTQKVLG
KRMIVNEDRHLTTNLLLRGWTVTYVSDTLTATDTPTTLSRWLLQQVRWGRATHIETFQQP
KVYLLNHPVFFWAAMKREVGPLIVFFSILYYLITGHPFVYFCWWDLVFRAGYTIFYNWLR
NPDRGPTNGYAWIIPALLFYNLPLPAIQIWSMATVLEGGWGTTMRSNSEMSKQNQSQLWK
RWHDLGFFVLWMGILGGTCARIAGGLLSWSDIVIFRAIWVGILAPSAVAFYALILS

Enzyme Prediction     

No EC number prediction in PMAA_050710-t26_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133056	GT2_HAS	2.81e-14	110	412	6	232	Hyaluronan synthases catalyze polymerization of hyaluronan. Hyaluronan synthases (HASs) are bi-functional glycosyltransferases that catalyze polymerization of hyaluronan. HASs transfer both GlcUA and GlcNAc in beta-(1,3) and beta-(1,4) linkages, respectively to the hyaluronan chain using UDP-GlcNAc and UDP-GlcUA as substrates. HA is made as a free glycan, not attached to a protein or lipid. HASs do not need a primer for HA synthesis; they initiate HA biosynthesis de novo with only UDP-GlcNAc, UDP-GlcUA, and Mg2+. Hyaluronan (HA) is a linear heteropolysaccharide composed of (1-3)-linked beta-D-GlcUA-beta-D-GlcNAc disaccharide repeats. It can be found in vertebrates and a few microbes and is typically on the cell surface or in the extracellular space, but is also found inside mammalian cells. Hyaluronan has several physiochemical and biological functions such as space filling, lubrication, and providing a hydrated matrix through which cells can migrate.
224136	BcsA	4.69e-11	208	499	98	363	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133045	CESA_like	1.81e-06	266	346	86	166	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
367353	Chitin_synth_2	0.008	260	378	203	337	Chitin synthase. Members of this family are fungal chitin synthase EC:2.4.1.16 enzymes. They catalyze chitin synthesis as follows: UDP-N-acetyl-D-glucosamine + {(1,4)-(N-acetyl-beta-D-glucosaminyl)}(N) <=> UDP + {(1,4)-(N-acetyl-beta-D-glucosaminyl)}(N+1).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA20888.1|GT2	0.0	44	596	47	599
QMW26501.1|GT2	4.09e-290	9	594	10	586
QRD87385.1|GT2	4.09e-290	9	594	10	586
QMW38580.1|GT2	4.09e-290	9	594	10	586
BAE55426.1|GT2	4.09e-290	9	594	10	586

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7SP7_A	4.46e-21	104	572	83	506	Chain A, Hyaluronan synthase [Paramecium bursaria Chlorella virus CZ-2]
7SP6_A	1.85e-20	104	572	83	506	Chain A, Hyaluronan synthase [Paramecium bursaria Chlorella virus CZ-2],7SP8_A Chain A, Hyaluronan synthase [Paramecium bursaria Chlorella virus CZ-2],7SP9_A Chain A, Hyaluronan synthase [Paramecium bursaria Chlorella virus CZ-2],7SPA_A Chain A, Hyaluronan synthase [Paramecium bursaria Chlorella virus CZ-2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q92839|HYAS1_HUMAN	4.36e-22	110	525	101	493	Hyaluronan synthase 1 OS=Homo sapiens OX=9606 GN=HAS1 PE=1 SV=2
sp|Q61647|HYAS1_MOUSE	5.91e-22	110	525	105	498	Hyaluronan synthase 1 OS=Mus musculus OX=10090 GN=Has1 PE=1 SV=1
sp|P04341|NODC_RHIME	1.34e-19	266	520	140	392	N-acetylglucosaminyltransferase OS=Rhizobium meliloti (strain 1021) OX=266834 GN=nodC PE=3 SV=1
sp|P17862|NODC_RHILO	7.56e-19	266	449	140	322	N-acetylglucosaminyltransferase OS=Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) OX=266835 GN=nodC PE=3 SV=2
sp|P04340|NODC_RHILV	5.85e-17	266	449	139	321	N-acetylglucosaminyltransferase OS=Rhizobium leguminosarum bv. viciae OX=387 GN=nodC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000015	0.000008

TMHMM  Annotations     

Start	End
27	46
442	464
490	512
545	567
572	594