CAZyme Information: PMAA_050030-t26_1-p1

Basic Information

• Species: Talaromyces marneffei
• Lineage: Ascomycota; Eurotiomycetes; ; Trichocomaceae; Talaromyces; Talaromyces marneffei
• CAZyme ID: PMAA_050030-t26_1-p1
• CAZy Family: GH171
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
775		83580.05	3.8624

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TmarneffeiATCC18224	10194	441960	145	10049

• Gene Location: location=DS995904:3070349-3072676(-)

Full Sequence      

MSSILAWVREDNTTIGAYTFPGFQIYGADDLDGLVTTTCQTALARTIRCPTYLTMYMSPR
VGQSTGNSTFTDLMCSSTCDSSLQSWYDDVSSSCANQTLDYADPTLLGGYTWQGYNETCL
KDPSSGEYCTGKKVFGCRPGDINSTIITDKHNVSDVVVSFSDADTMESMPTDELYSWCWT
QMVIMMQNSSYSAFNDYYQSGMQYMVSECSLSASITMPESLIYPRPTVTPMCLSDVNYTI
QAGDTCDSIAIAYNVTSASILTNNPMFVNNCSSLIPGNTICMPLPCTPLYTLQPDDDCMT
VEWKNGLRDGTLRQYNPCINYFCDNLQESTEILGSVLCLGPQAGKFVSNSSFLPNPPATS
NPSTGYSMYVIDPPINATLANGTTTLCGSWYTVNEGDTCAQICSMESIPSSLFLACNPTL
NSTNCDANLVVNTTYCVAPMINWDDPSFWVDDDTAPTTSSFKDDFSSGSMAQWMTYDGSF
GASSGALVGSNSFGGKALINSNYGNFLYEVDVTLPSASGNAGLVFRVTNPSVGADAYNGY
YAGISTSSVFVGRASNSWTPLGSAQVDLAINQLHHVKVEVVDTTLNIFVDDMNKVLVSVT
DGTYTSGMNGVRVYGTEATFDNIQFNPLIFRDDFSSGTMGKWTTIDGQYQVSSNVAVLTA
SPAAKAVTTGVTSADIIYEAEISINSTPNGNGGMIFRVSNAAPGADTYNGYYVGIGIGYV
VFGFADTNWNEIKRVDAADINAGQIYHLAIQTSGDSISIFVDDLNTPRMVVKDDK

Enzyme Prediction     

EC	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM66	471	623	5.5e-32	0.9741935483870968
CBM66	640	773	8e-19	0.832258064516129

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
197609	LysM	5.71e-07	238	281	2	43	Lysin motif.
212030	LysM	6.85e-07	238	280	3	43	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
396179	LysM	3.26e-05	238	283	1	43	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.
399445	DUF1080	0.005	630	763	2	140	Domain of Unknown Function (DUF1080). This family has structural similarity to an endo-1,3-1,4-beta glucanase belonging to glycoside hydrolase family 16. However, the structure surrounding the active site differs from that of the endo-1,3-1,4-beta glucanase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA16072.1|CBM50|CBM66	0.0	1	775	1	751
QGA13089.1|CBM66	2.90e-186	457	774	302	619
CAK47332.1|GH55	1.42e-110	1	449	895	1316
UKZ81890.1|CBM66	3.90e-97	456	774	293	610
UKZ56147.1|CBM66	2.14e-91	456	774	300	616

PDB Hits     

PMAA_050030-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4ALG0|LYSM1_ARTBC	2.47e-08	219	438	142	372	LysM domain-containing protein ARB_05157 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_05157 PE=1 SV=1
sp|D4AVW3|LYSM5_ARTBC	4.58e-07	13	437	26	534	LysM domain-containing protein ARB_00327 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_00327 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000043	0.000004

TMHMM  Annotations     

There is no transmembrane helices in PMAA_050030-t26_1-p1.