CAZyme Information: PMAA_049720-t26_1-p1

Basic Information

• Species: Talaromyces marneffei
• Lineage: Ascomycota; Eurotiomycetes; ; Trichocomaceae; Talaromyces; Talaromyces marneffei
• CAZyme ID: PMAA_049720-t26_1-p1
• CAZy Family: GH17
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
375	DS995904|CGC11	43552.69	8.9482

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TmarneffeiATCC18224	10194	441960	145	10049

• Gene Location: location=DS995904:2979849-2981038(-)

Full Sequence      

MSRIRVRPLAGLLTLFCTLYFLISNTLGFIRIFSSPHSGIALSQSGIRTAYYNHTIDETH
DPLIPRKIHQIYHDWSGQGGNVPHTAQWMRLRDSCINRNPGWEYKLWSSAESREFLQREY
SWFLPIYDSYRHPVQRVDALKYFIMRHYGGIYIDMDNGCLESLEPLRYYPAFVTDGGEGP
LFINILGAAPHHPFYEYLTNNIWAYNLFYYPFPYLAVSYNSGRWFFTSMWEKYHDSVNRR
NWNLVHSAGEGADQIHTDTTNKNQLYRVVMESRRGAEPWVFWNEGAGLTWEDWDFSIFHW
IGENAAKVIRITVAVTASLSLLTGLVVWKCCCKRRKAKSNATGGLKSVAALLTPVLTPAK
EKRVEFFFKKGHDMV

Enzyme Prediction     

No EC number prediction in PMAA_049720-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	88	167	3e-19	0.9333333333333333

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	1.10e-27	55	310	73	310	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	5.56e-18	88	172	4	92	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA16047.1|GT32	2.35e-292	1	375	1	375
QKX60406.1|GT32	3.58e-147	4	375	3	352
QBZ58620.1|GT32	1.43e-90	21	345	25	339
QGA12364.1|GT32	1.14e-85	24	342	28	327
UNI16793.1|GT32	6.66e-85	29	336	37	321

PDB Hits     

PMAA_049720-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q10323|IMT3_SCHPO	2.08e-37	52	245	45	230	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	4.55e-36	57	233	75	243	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|P38287|CSH1_YEAST	6.07e-36	52	233	50	223	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|P33300|SUR1_YEAST	4.85e-34	63	233	54	216	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|O14084|IMT1_SCHPO	2.70e-29	64	336	64	304	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.972968	0.027043

TMHMM  Annotations     

Start	End
12	34
306	328