CAZyme Information: PMAA_045040-t26_1-p1

Basic Information

• Species: Talaromyces marneffei
• Lineage: Ascomycota; Eurotiomycetes; ; Trichocomaceae; Talaromyces; Talaromyces marneffei
• CAZyme ID: PMAA_045040-t26_1-p1
• CAZy Family: GH16
• CAZyme Description: beta-mannosidase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
858		98197.68	5.1889

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TmarneffeiATCC18224	10194	441960	145	10049

• Gene Location: location=DS995904:1695768-1698572(-)

Full Sequence      

MAFLQQRLSTGWTFKDRDSEELDAWMPVPTIPSTVQQDLIANNKLENPYIGFNELKARWV
NEKSWIYRHAFQQPEIPTGATVVLVFDGLDTFASCKLDGQMILESDNMFMGYRVDVTEAL
QNSPEGGQHVLEIEFDCAQSRARKIRSEHPDHKWTGFNGDMARLAVRKAQYHWGWDWGPV
IMTAGIWRDVRLEVYSARVADLWPKTTKIDFNGKVASVTAIARIDTSASTLLKDLTASFR
LSLRGQEIARQENIPVNNIDQVAQAEFQVSDPELWWPHGYGSQPLYKVSVSLSHNGKELH
DTSKKFGIRSAEIIQQLDKHGKSFFFQINGVDVFCGGSCWIPADSLLPSIDAERYRKWIE
LMVAGGQVMIRVWGGGIYEDDRFYEACDELGVLVWQDFMFGCGNYPAWPKMLDSIRQEAI
YNVQRLRHHPSIVIYVGNNEDYQVQEHAKLTYDYDDKDPDNWLKSDFPARYIYEKVLPEV
VAEYSPSTFYHPGSPWGDGKITSDPTVGDMHQWNVWHGTQEKYQIFASLGGRFNSEFGME
AFPHLSTIDYFVENEEDKFPQSHVLDFHNKADGHERRLATYLVENLRMATDLETYLYLTQ
VVQAETMMFGYRGWRRQWGDSRHCGGALLWQLNDCWPTISWSIVDYFLRPKPAYYTVKRA
LKTLTIGVQREHHDWSVAHAQPPTKSRYELWVASSRQDEVFNATVELQFLSVVSGRDIRA
PVLFENITIAANGTTDMITDGIIDHVAEPEAHVLSARLWVNGLIVARDVDWPQPFKYLDF
SDRGLEVNPETTISAAGERQQIIKISARKPMKCLVFEERDGVRVSDSAIDIVPGDEQVVT
VTGLGESDTPLKYRYLGQ

Enzyme Prediction     

EC	3.2.1.25:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	6	679	2.5e-96	0.6276595744680851

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225789	LacZ	1.61e-83	5	658	12	627	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
407658	Mannosidase_ig	1.18e-13	686	777	1	91	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.
395572	Glyco_hydro_2	1.27e-11	197	309	1	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
397119	Glyco_hydro_2_C	4.86e-04	380	524	61	202	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
236657	PRK10150	0.001	184	330	168	289	beta-D-glucuronidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA15573.1|GH2	0.0	1	858	1	858
QKX60969.1|GH2	0.0	1	858	1	844
CAP93354.1|GH2	0.0	1	858	1	845
CAV33708.1|GH2	0.0	1	858	1	845
CAP96278.1|GH2	0.0	1	858	1	838

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5N6U_A	6.58e-146	7	669	28	661	Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_B Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_C Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_D Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12]
2VJX_A	1.51e-127	8	842	11	817	Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]
2JE8_A	1.59e-127	8	842	13	819	Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JE8_B Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
7OP6_A	1.63e-127	8	842	13	819	Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP6_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_A Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482]
2WBK_A	4.26e-127	8	842	11	817	Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482],2WBK_B Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2TXB7|MANBB_ASPOR	0.0	2	858	3	844	Beta-mannosidase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=mndB PE=3 SV=3
sp|B8NW36|MANBB_ASPFN	0.0	2	858	3	844	Beta-mannosidase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=mndB PE=3 SV=1
sp|Q0CCA0|MANBB_ASPTN	0.0	2	858	3	843	Beta-mannosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mndB PE=3 SV=2
sp|A1D911|MANBB_NEOFI	0.0	1	858	1	845	Beta-mannosidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=mndB PE=3 SV=1
sp|Q4WAH4|MANBB_ASPFU	0.0	1	858	1	845	Beta-mannosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=mndB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000085	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PMAA_045040-t26_1-p1.