CAZyme Information: PMAA_042280-t26_1-p1

Basic Information

• Species: Talaromyces marneffei
• Lineage: Ascomycota; Eurotiomycetes; ; Trichocomaceae; Talaromyces; Talaromyces marneffei
• CAZyme ID: PMAA_042280-t26_1-p1
• CAZy Family: GH16
• CAZyme Description: aryl-alcohol dehydrogenase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
612	DS995904|CGC7	66195.09	5.3806

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TmarneffeiATCC18224	10194	441960	145	10049

• Gene Location: location=DS995904:939549-941459(+)

Full Sequence      

MPSVDTSSLADLRQQYDYIVVGGGTSGLVVASRLTEDPAVSVLVLEAGSNRVSDPRIAVP
GLAASTYFDPEFDWCLTSVPQENLNGRSLAEPRGRTLGGSSAINLGMVIYPSQADIDAWE
ELGNDGWNWKSISHYMRKSQTLTLPSDEIKQELSLQYIDPAVQGQTGPINVSFGNGPFPA
FNQTWPKAFENLGHKLTGDPMSGVAKGAFCGPGSIHPETRARSHAGVAYYNEEVAKRPNL
RVVTEVLVEKILLEKDGDKDAIATGVLYATKDGVQKTFSANREVILAAGSIKTPHLLELS
GIGNCALLESHGIKPIINNANVGENLQEHGFVPFSWEAAEGQATGEALRNPEIGAAAMAA
WQQSGAGPLGLCPLPSAFMPLPESQDGELNALFDKYLGDKAVPPVLKTQYKLLRRMLEDK
EEPTGQYTMAPFQILPEKGPSPKGIFGMTEPENFVSIVSVLNRPFSRGTVHLASPDTKAL
PVFDPAFFSHPLDLELHARHVRWLETLAWSEPLASLLKTDGRRLQNSSPDMSLETARELA
RDRIVCHYHVVGTAAMLPREQGGVVDSHLKVYGTQNLRVVDASIIPIIPRGNTQAIVFAV
AEKAADTIKGDK

Enzyme Prediction     

No EC number prediction in PMAA_042280-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	14	610	6.1e-172	0.9964788732394366

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	3.19e-95	15	612	7	537	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	1.07e-86	14	612	4	535	choline dehydrogenase; Validated
398739	GMC_oxred_C	6.10e-35	464	604	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	3.31e-31	85	329	15	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	4.64e-26	3	597	43	565	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA17771.1|AA3_2	0.0	1	612	1	612
BCS13057.1|AA3_2	7.18e-307	5	612	5	614
BCS01313.1|AA3_2	7.18e-307	5	612	5	614
CAK40027.1|AA3_2	8.81e-303	5	612	4	613
BCS27275.1|AA3_2	3.90e-222	1	611	1	616

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4YNT_A	1.24e-75	16	611	6	567	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
5OC1_A	2.26e-73	16	612	2	565	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	1.23e-72	16	612	3	566	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
6ZE2_A	4.89e-68	11	609	1	583	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
6O9N_A	9.90e-67	9	608	29	638	Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus],6O9N_B Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A161CEV4|CITC_MONRU	1.43e-83	12	611	10	611	Dehydrogenase citC OS=Monascus ruber OX=89489 GN=citC PE=1 SV=1
sp|A0A142PTM2|CITC_MONPU	1.43e-83	12	611	10	611	Dehydrogenase mpl7 OS=Monascus purpureus OX=5098 GN=mpl7 PE=1 SV=1
sp|A0A5C1RDA6|ASC9_DIDFA	2.05e-82	17	611	15	619	Dehydrogenase OS=Didymella fabae OX=372025 GN=orf9 PE=3 SV=1
sp|Q5GMY3|GMCH_MALSM	8.30e-79	14	611	45	618	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2
sp|M5EAX2|GMCH_MALS4	8.30e-79	14	611	45	618	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000025	0.000021

TMHMM  Annotations     

There is no transmembrane helices in PMAA_042280-t26_1-p1.