CAZyme Information: PMAA_039000-t26_1-p1

Basic Information

• Species: Talaromyces marneffei
• Lineage: Ascomycota; Eurotiomycetes; ; Trichocomaceae; Talaromyces; Talaromyces marneffei
• CAZyme ID: PMAA_039000-t26_1-p1
• CAZy Family: GH152
• CAZyme Description: endoglucanase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
847	DS995904|CGC2	89242.40	4.9419

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TmarneffeiATCC18224	10194	441960	145	10049

• Gene Location: location=DS995904:51004-53904(-)

Full Sequence      

MTFGVGGPSLLTVCLLATSVSSAVLQAYTWKNVKTGGGGGFTPSIVFNPSVPGVAYARTD
IGGPYRLNQDDTWTPLLDSVNNSNWHNWGIDALATDPVDTKRLYLAVGMYTNDWDPNPGS
ILRSTDSGTTWQETVLPFKVGGNMPGRGVGERLAVDPNKNSIVYFGARSGHGLWKSTDYG
VTWSNVTSFTWTGTYFQNASSSYTADPVGIAWVTFDTTSGTKGSLTPRIFVGVVDTGKSV
FKSEDGGVTWAWVSGEPMYGFLPHKGILSPVEKTLYISYSNGAGPYDGTNGTVHKYNIST
GVWTDISPTPMASTNYGYGGLAVDLQVPGTVMVAALNCWWPDELIWRSLDSGATWSPIWA
WNGYPNLNYYYNYDISNAPWLQDNTSTAQFPVSVGWMVEALAIDPFDSNHWLYGTGATIY
GGHDLLKWDSNHNVTVKSLAVGIEEMAVLGLISPPGGPPLLSAVGDDGGFYHSDLDKAPN
QYFHDPTYSSTNGIDYAGNKPSYIVRSGSSSTLPTVSISTDFGLTWSADYAASSSTVPGS
VAISADGDTVLLTSTTGSPLISKYSSSFSTVSGLPSSAVIASDKSNNTVFYGGHAGNFYT
STDGGVSFTKTVSLGSSAAVNTIRAHPSIAGDVWASTDTGLWHSTNSGSTFTQIGSSCTA
GWSFGFGKAATTGSYPVIFGFFTIDGVTALFKTEDIGVNWQMISDATHGFGSSSANVVNG
DMSNYGRVFVGTNGRGIWYGEPSGSLPSSTASGTKTSATGITSSTSSITKSTSATITTSS
IKSTSSSTTRTSSVVTTTTSGTSATAAPYGQCGGSEYTGPTVCPSGWTCTFYNDYYSQCK
IYHSVAL

Enzyme Prediction     

EC	3.2.1.151:27	3.2.1.150:4	3.2.1.151:5	3.2.1.151:27	3.2.1.150:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH74	78	188	8.4e-24	0.4592274678111588

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
197593	fCBD	8.17e-13	807	839	1	33	Fungal-type cellulose-binding domain. Small four-cysteine cellulose-binding domain of fungi
395595	CBM_1	4.11e-12	808	836	1	29	Fungal cellulose binding domain.
406353	Sortilin-Vps10	4.20e-04	72	193	12	123	Sortilin, neurotensin receptor 3,. Sortilin, also known in mammals as neurotensin receptor-3, is the archetypical member of a Vps10-domain (Vps10-D) that binds neurotrophic factors and neuropeptides. This domain constitutes the entire luminal part of Sortilin and is activated in the trans-Golgi network by enzymatic propeptide cleavage. The structure of the domain has been determined as a ten-bladed propeller, with up to 9 BNR or beta-hairpin turns in it. The mature receptor binds various ligands, including its own propeptide (Sort-pro), neurotensin, the pro-forms of nerve growth factor-beta (NGF)6 and brain-derived neurotrophic factor (BDNF)7, lipoprotein lipase (LpL), apo lipoprotein AV14 and the receptor-associated protein (RAP)1.
271234	Sialidase_non-viral	5.84e-04	102	250	157	293	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
214740	VPS10	0.002	119	196	55	129	VPS10 domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA17431.1|CBM1|GH74	0.0	1	847	1	847
AAK77227.1|CBM1|GH74|3.2.1.151	0.0	16	846	13	853
CAK43558.1|CBM1|GH74	0.0	16	838	13	845
EAA60055.1|CBM1|GH74	0.0	22	838	22	824
BAA29031.1|CBM1|GH74	0.0	9	839	7	853

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6MGL_A	1.27e-234	26	742	4	746	Crystal structure of the catalytic domain from GH74 enzyme PoGH74 from Paenibacillus odorifer, D60A mutant in complex with XXLG and XGXXLG xyloglucan [Paenibacillus odorifer]
6MGJ_A	3.00e-230	26	742	4	746	Crystal structure of the catalytic domain from GH74 enzyme PoGH74 from Paenibacillus odorifer, apoenzyme [Paenibacillus odorifer],6MGJ_B Crystal structure of the catalytic domain from GH74 enzyme PoGH74 from Paenibacillus odorifer, apoenzyme [Paenibacillus odorifer],6MGJ_C Crystal structure of the catalytic domain from GH74 enzyme PoGH74 from Paenibacillus odorifer, apoenzyme [Paenibacillus odorifer],6MGJ_D Crystal structure of the catalytic domain from GH74 enzyme PoGH74 from Paenibacillus odorifer, apoenzyme [Paenibacillus odorifer],6MGJ_E Crystal structure of the catalytic domain from GH74 enzyme PoGH74 from Paenibacillus odorifer, apoenzyme [Paenibacillus odorifer],6MGJ_F Crystal structure of the catalytic domain from GH74 enzyme PoGH74 from Paenibacillus odorifer, apoenzyme [Paenibacillus odorifer],6MGJ_G Crystal structure of the catalytic domain from GH74 enzyme PoGH74 from Paenibacillus odorifer, apoenzyme [Paenibacillus odorifer],6MGJ_H Crystal structure of the catalytic domain from GH74 enzyme PoGH74 from Paenibacillus odorifer, apoenzyme [Paenibacillus odorifer],6MGK_A Crystal structure of the catalytic domain from GH74 enzyme PoGH74 from Paenibacillus odorifer, in complex with XLX xyloglucan [Paenibacillus odorifer],6MGK_B Crystal structure of the catalytic domain from GH74 enzyme PoGH74 from Paenibacillus odorifer, in complex with XLX xyloglucan [Paenibacillus odorifer],6MGK_C Crystal structure of the catalytic domain from GH74 enzyme PoGH74 from Paenibacillus odorifer, in complex with XLX xyloglucan [Paenibacillus odorifer],6MGK_D Crystal structure of the catalytic domain from GH74 enzyme PoGH74 from Paenibacillus odorifer, in complex with XLX xyloglucan [Paenibacillus odorifer]
6P2N_A	1.46e-225	23	742	1	747	Crystal structure of Paenibacillus graminis GH74 (PgGH74) [Paenibacillus graminis]
4LGN_A	4.39e-222	23	745	2	738	The structure of Acidothermus cellulolyticus family 74 glycoside hydrolase [Acidothermus cellulolyticus 11B]
6P2O_A	1.29e-212	26	743	1	727	Crystal structure of Streptomyces rapamycinicus GH74 in complex with xyloglucan fragments XLLG and XXXG [Streptomyces rapamycinicus NRRL 5491],6P2O_B Crystal structure of Streptomyces rapamycinicus GH74 in complex with xyloglucan fragments XLLG and XXXG [Streptomyces rapamycinicus NRRL 5491]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q7Z9M8|XG74_HYPJQ	2.63e-262	27	839	20	837	Xyloglucanase OS=Hypocrea jecorina (strain QM6a) OX=431241 GN=cel74a PE=1 SV=1
sp|Q3MUH7|XG74_PAESP	4.50e-237	16	759	26	788	Xyloglucanase OS=Paenibacillus sp. OX=58172 GN=xeg74 PE=1 SV=1
sp|A3DFA0|XG74_ACET2	2.44e-208	17	750	27	766	Xyloglucanase Xgh74A OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=xghA PE=3 SV=1
sp|Q70DK5|XG74_ACETH	9.70e-208	17	750	27	766	Xyloglucanase Xgh74A OS=Acetivibrio thermocellus OX=1515 GN=xghA PE=1 SV=1
sp|Q5BD38|XGCA_EMENI	1.98e-86	6	741	6	807	Oligoxyloglucan-reducing end-specific xyloglucanase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=xgcA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.962304	0.037721

TMHMM  Annotations     

There is no transmembrane helices in PMAA_039000-t26_1-p1.