CAZyme Information: PMAA_035680-t26_1-p1

Basic Information

• Species: Talaromyces marneffei
• Lineage: Ascomycota; Eurotiomycetes; ; Trichocomaceae; Talaromyces; Talaromyces marneffei
• CAZyme ID: PMAA_035680-t26_1-p1
• CAZy Family: GT8
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
459	DS995899|CGC25	52955.95	5.6230

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TmarneffeiATCC18224	10194	441960	145	10049

• Gene Location: location=DS995899:5540217-5541659(+)

Full Sequence      

MQTQSSLHRLHHGRLRIWILAFAPILSLVLLWTWLRRPNSLLLDQYFSTDGKGADDGSIN
NVKPKPIPEMDEILVILKTGVTESLSKVPVHLETTLSSIPHFVVFSDYEEEIAGIRTHDV
LRGIDEATKRKVPEFELYNRIREHGRDALTPADYGDDSNGPWGRQNNPGWRLDKWKFLPM
IPAALDYKPDAKWFVFMEADSYIFWPNLVEWLSQLNHEQDWYLGFPMQIGNTIFAYGGSG
FVVSNPAMRKTAQYVEEQPQTEIDNYTATQWAGDCVLGKMFRDAGVGLHWSWPMFQDSRL
WEMDYFATIGGRRAWCYPVVSYHHMQPDDIRGLYEFESEWFKSGNSSTKLLLFSDMFYRL
ILSDILSLRDGWDNAADNAITNKEGSSLVLTFEECSNICANNKSCLSYRYRENDKNCYVS
SAVKRGTAAEGVKSNWMIDRIHNKIREYGETCKNVEFVL

Enzyme Prediction     

No EC number prediction in PMAA_035680-t26_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
367085	Fringe	2.17e-06	187	250	81	158	Fringe-like. The drosophila protein fringe (FNG) is a glucosaminyltransferase that controls the response of the Notch receptor to specific ligands. FNG is localized to the Golgi apparatus (not secreted as previously thought). Modification of Notch occurs through glycosylation by FNG. The xenopus homolog, lunatic fringe, has been implicated in a variety of functions.
394981	PAN_1	1.49e-05	389	439	22	71	PAN domain. The PAN domain contains a conserved core of three disulphide bridges. In some members of the family there is an additional fourth disulphide bridge the links the N and C termini of the domain. The domain is found in diverse proteins, in some they mediate protein-protein interactions, in others they mediate protein-carbohydrate interactions.
238531	PAN_AP_plant	3.62e-05	386	419	28	61	Plant PAN/APPLE-like domain; present in plant S-receptor protein kinases and secreted glycoproteins. PAN/APPLE domains fulfill diverse biological functions by mediating protein-protein or protein-carbohydrate interactions. S-receptor protein kinases and S-locus glycoproteins are involved in sporophytic self-incompatibility response in Brassica, one of probably many molecular mechanisms, by which hermaphrodite flowering plants avoid self-fertilization.
214680	PAN_AP	0.001	389	421	24	57	divergent subfamily of APPLE domains. Apple-like domains present in Plasminogen, C. elegans hypothetical ORFs and the extracellular portion of plant receptor-like protein kinases. Predicted to possess protein- and/or carbohydrate-binding functions.
238533	APPLE_Factor_XI_like	0.008	370	434	10	69	Subfamily of PAN/APPLE-like domains; present in plasma prekallikrein/coagulation factor XI, microneme antigen proteins, and a few prokaryotic proteins. PAN/APPLE domains fulfill diverse biological functions by mediating protein-protein or protein-carbohydrate interactions.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA14390.1|GT31	0.0	1	459	1	459
CAP92758.1|GT31	4.52e-137	70	458	80	463
QQK46394.1|GT31	1.07e-135	69	458	80	464
QRD94340.1|GT31	8.80e-128	66	457	46	425
BAE63422.1|GT31	8.80e-128	66	457	46	425

PDB Hits     

PMAA_035680-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

PMAA_035680-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000031	0.000017

TMHMM  Annotations     

Start	End
13	35