CAZyme Information: PMAA_031200-t26_1-p1

Basic Information

• Species: Talaromyces marneffei
• Lineage: Ascomycota; Eurotiomycetes; ; Trichocomaceae; Talaromyces; Talaromyces marneffei
• CAZyme ID: PMAA_031200-t26_1-p1
• CAZy Family: GH105
• CAZyme Description: alpha-1,3-mannosyltransferase (Alg3), putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
414		46256.41	8.5268

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TmarneffeiATCC18224	10194	441960	145	10049

• Gene Location: location=DS995899:4336501-4337858(-)

Full Sequence      

MAISNTIVNILTKPKYSLWIAPLLVLVDAVLSALIIKKVSYTEIDWTTYMQQIALYQAGE
RDYTAIKGDTGPLVYPASHVYIYSFLYELTNKGQDIELGQYIFAGIYIATLIVVLSCYIK
AGAPPYLLPLLVLSKRLHSIYMLRLFNDGIATLAMWVAIFFFQRRQLTVATTVWSLGVGV
KMSLLLLAPGVAIVIALSGGIWAAVPLALNAVLTQVLLGIPFLQENAIGYVSRAFELTRQ
FLHVWTVNWRFIDEEVFNSSVFALNLLVLHVVLILAFLATRWIRPSGEEINIFAQTFLEG
RSTKSPLSSKYITTTILSSMVIGMLCARSLHYQFYAYLAWTTPFLLWQANFHPVLVYTVW
AVQEWGWNVFPSTNASSAAVVGCLAVQVVMLLANDNFSQGPLDEKATAEQQKTK

Enzyme Prediction     

EC	2.4.1.258:10

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT58	21	377	4.8e-144	0.9972527472527473

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398745	ALG3	0.0	22	377	1	358	ALG3 protein. The formation of N-glycosidic linkages of glycoproteins involves the ordered assembly of the common Glc3Man9GlcNAc2 core-oligosaccharide on the lipid carrier dolichyl pyrophosphate. Whereas early mannosylation steps occur on the cytoplasmic side of the endoplasmic reticulum with GDP-Man as donor, the final reactions from Man5GlcNAc2-PP-Dol to Man9GlcNAc2-PP-Dol on the lumenal side use Dol-P-Man. ALG3 gene encodes the Dol-P-Man:Man5GlcNAc2-PP-Dol mannosyltransferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA13922.1|GT58	2.48e-291	1	414	1	414
QKX58543.1|GT58	4.61e-192	1	398	146	543
BCR98022.1|GT58	3.59e-167	13	394	13	394
BCS10476.1|GT58	3.59e-167	13	394	13	394
BAE62911.1|GT58	2.10e-161	1	394	1	394

PDB Hits     

PMAA_031200-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WVG2|ALG3_ASPFU	3.45e-164	1	409	9	416	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=alg3 PE=3 SV=1
sp|Q2U6A4|ALG3_ASPOR	3.73e-162	1	394	1	394	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=alg3 PE=3 SV=1
sp|A1DDZ3|ALG3_NEOFI	4.07e-156	1	409	1	408	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=alg3 PE=3 SV=1
sp|A1CBE6|ALG3_ASPCL	8.05e-156	1	401	63	463	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=alg3 PE=3 SV=1
sp|A2RA94|ALG3_ASPNC	8.86e-140	13	394	13	390	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=alg3 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000043	0.000003

TMHMM  Annotations     

Start	End
17	36
73	90
103	125
140	162
174	196
201	223
261	283