CAZyme Information: PMAA_027980-t26_1-p1

Basic Information

• Species: Talaromyces marneffei
• Lineage: Ascomycota; Eurotiomycetes; ; Trichocomaceae; Talaromyces; Talaromyces marneffei
• CAZyme ID: PMAA_027980-t26_1-p1
• CAZy Family: GH105
• CAZyme Description: N-glycosyl-transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
411	DS995899|CGC17	46588.89	6.3750

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TmarneffeiATCC18224	10194	441960	145	10049

• Gene Location: location=DS995899:3422583-3424022(-)

Full Sequence      

MLLPKGGVNWKSARSRLPPWRAVLILLTRTRFLVSIAVVGLVVLLWRGISSSAAEMQSFY
CYGPSKSPMHMTINEMNEWNAHLQTPVNFNHHEPYDVNSTSVSFINLNPIKTTPNAAANG
ERVLILTPLRDAAPYLPKYFDLLSILTYPHDLIDLAFLVGDSTDDTLGVLSSELNLIQSQ
VEQKVAFRSATIIQKDFGSDIEMNVAEKHSFEAQGPRRKSIARARNFLLYSALKPDHSWV
YWRDVDIVDSPEKILEDFMAHDKDILVPNIWFHRYENGHDIEGKFDYNSWIESDKGRRLA
ESLPKDTILAEGYKQYDTGRTYLVKLGDWRNNKDEEVELDGVGGVNILVKADVHRAGINF
PAYSFENQAETEGFAKMAKRAGYQVVGLPNYIVWHIDTEEKPGNLGGRKAY

Enzyme Prediction     

No EC number prediction in PMAA_027980-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT62	100	364	5.1e-108	0.9888059701492538

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397491	Anp1	1.33e-157	101	364	1	265	Anp1. The members of this family (Anp1, Van1 and Mnn9) are membrane proteins required for proper Golgi function. These proteins co-localize within the cis Golgi, and that they are physically associated in two distinct complexes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA13607.1|GT62	4.08e-309	1	411	1	411
QKX56390.1|GT62	3.19e-281	1	411	1	411
CAP99070.1|GT62	7.54e-255	1	411	1	412
BCR85123.1|GT62	1.17e-254	1	405	1	405
QQK44843.1|GT62	8.79e-254	1	411	1	412

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ZF8_A	3.46e-65	102	399	6	303	Crystal structure of Saccharomyces cerevisiae Mnn9 in complex with GDP and Mn. [Saccharomyces cerevisiae S288C]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P32629|ANP1_YEAST	2.20e-99	98	396	58	355	Mannan polymerase II complex ANP1 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ANP1 PE=1 SV=3
sp|O74745|ANP1_SCHPO	8.89e-93	121	396	98	372	Mannan polymerase II complex anp1 subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=anp1 PE=3 SV=1
sp|Q00314|VAN1_CANAX	5.57e-78	96	396	70	419	Vanadate resistance protein OS=Candida albicans OX=5476 GN=VAN1 PE=3 SV=1
sp|P23642|VAN1_YEAST	4.40e-77	100	396	170	512	Mannan polymerase I complex VAN1 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VAN1 PE=1 SV=3
sp|P53697|MNN9_CANAL	3.39e-69	96	395	67	365	Mannan polymerase complex subunit MNN9 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN9 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999995	0.000009

TMHMM  Annotations     

There is no transmembrane helices in PMAA_027980-t26_1-p1.