CAZyme Information: PMAA_024790-t26_1-p1

Basic Information

• Species: Talaromyces marneffei
• Lineage: Ascomycota; Eurotiomycetes; ; Trichocomaceae; Talaromyces; Talaromyces marneffei
• CAZyme ID: PMAA_024790-t26_1-p1
• CAZy Family: CE9|CE9
• CAZyme Description: capsule-associated protein CAP1, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
590	DS995899|CGC4	68320.98	5.4011

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TmarneffeiATCC18224	10194	441960	145	10049

• Gene Location: location=DS995899:2588514-2590340(-)

Full Sequence      

MRVSRIIYLLCFLTIAALTLFFLRKHEIDAGPKAPFEKSLPADFENLLPPTTEDSHPIAR
LINDANAKFDEKLARQSKTLTEAVEEYRRRYGMPPPPHFDKWFSFAKTRGVQMIDEYDTI
YHSLLPFWALSPGVIRSRVHEALGYDNALIGLLIRDGQVTKVEGGGDGYHWQREATAGMM
ESFLKYLPDMDLAFNIHDEPRVVVPHDDLQRLVSYAKDTVIPATLEKTSLHNKWSPRPSD
LNKGDRIEEVRTTRFNRFAHQPTWTHSRLSCPVDSPARSLDENVADNMESYATSDLGFIY
NTTAFSDICLSPSLANTFGFFDRPNAFNIVLDLFPIFSQSKISSFQDILYPSPWYWIGKV
IYNATRDFVWEDKIDQMYWRGSTTGGFSRDGGWRRQHRQLFVKNINSASNATIFTQMEDG
RWTTSNVPRQDVESLFNVTFTYVGQCDPGDCHAQEEYFDITPSVDQQDAWAFKYLLDIDG
NAFSGRYHAFLRSNSLIYKMAVFREWQDEWIDAWVHYVPLGMKGTDTVESVRYFTQEEEG
KIQAPRLAKQGKEWAQKVLRNEDLEVWFFRLLLEYGRLIDDDRENIGYMP

Enzyme Prediction     

No EC number prediction in PMAA_024790-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	312	579	7.2e-78	0.98

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	1.54e-17	335	578	32	252	Putative lipopolysaccharide-modifying enzyme.
310354	Glyco_transf_90	1.29e-10	335	578	108	322	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA13289.1|GT90	0.0	1	590	1	590
QKX56622.1|GT90	0.0	1	588	298	886
BCR83603.1|GT90	3.24e-288	1	589	1	599
UCK57446.1|GT90	1.81e-280	1	588	11	617
BAE54850.1|GT90	7.24e-280	1	588	1	607

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5F84_A	1.33e-06	335	579	154	379	Crystal structure of Drosophila Poglut1 (Rumi) complexed with its glycoprotein product (glucosylated EGF repeat) and UDP [Drosophila melanogaster],5F85_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) and UDP [Drosophila melanogaster],5F86_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) [Drosophila melanogaster],5F87_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_B Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_C Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_D Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_E Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_F Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster]
5L0R_A	4.80e-06	335	579	118	342	human POGLUT1 in complex with Notch1 EGF12 and UDP [Homo sapiens],5L0S_A human POGLUT1 in complex with Factor VII EGF1 and UDP [Homo sapiens],5L0T_A human POGLUT1 in complex with EGF(+) and UDP [Homo sapiens],5L0U_A human POGLUT1 in complex with EGF(+) and UDP-phosphono-glucose [Homo sapiens],5L0V_A human POGLUT1 in complex with 2F-glucose modified EGF(+) and UDP [Homo sapiens],5UB5_A human POGLUT1 in complex with human Notch1 EGF12 S458T mutant and UDP [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5K8R6|CXT1_CRYNJ	4.83e-62	55	585	151	662	Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CXT1 PE=1 SV=1
sp|B0X1Q4|RUMI_CULQU	4.84e-11	335	579	164	389	O-glucosyltransferase rumi homolog OS=Culex quinquefasciatus OX=7176 GN=CPIJ013394 PE=3 SV=1
sp|Q16QY8|RUMI_AEDAE	1.01e-07	335	579	163	388	O-glucosyltransferase rumi homolog OS=Aedes aegypti OX=7159 GN=AAEL011121 PE=3 SV=1
sp|Q6UW63|PLGT2_HUMAN	3.83e-07	452	578	342	466	Protein O-glucosyltransferase 2 OS=Homo sapiens OX=9606 GN=POGLUT2 PE=1 SV=1
sp|A0NDG6|RUMI_ANOGA	9.51e-07	335	579	163	386	O-glucosyltransferase rumi homolog OS=Anopheles gambiae OX=7165 GN=AGAP004267 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.998365	0.001664

TMHMM  Annotations     

Start	End
7	24