CAZyme Information: PMAA_024050-t26_1-p1

Basic Information

• Species: Talaromyces marneffei
• Lineage: Ascomycota; Eurotiomycetes; ; Trichocomaceae; Talaromyces; Talaromyces marneffei
• CAZyme ID: PMAA_024050-t26_1-p1
• CAZy Family: CE5
• CAZyme Description: alpha-L-rhamnosidase B, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
685		74520.00	5.2320

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TmarneffeiATCC18224	10194	441960	145	10049

• Gene Location: location=DS995899:2374931-2377102(-)

Full Sequence      

MVLLSKISLVQFWTLALSVTAEAGNCWRNTTCTGPIDTSFPGAWEKNIYAPASRQVRPQS
ILEASDSRTDFKVGSGHNVLTGNGSQIVFDFGIEVGGIVSVNYTASAAGSALNLAFSEAK
NWIGKFSDSSNGAFKRGDGYLTCYITEAGEGVYTIPDNKLRGGFRYLTVFLTTNDTSDAT
LEVNDITLEIGFLPTWSNLRAYQGYFHSNDELLNRIWYSGAYTIQTNMVPVNTGRQIPAV
AYGWDNNATLGPGDTIIVDGAKRDRAVWPGDMGIAVPATFVSIGDLESVKNGLQVMYNTQ
ASTGAFAESGPPLSQKGSDTYHMWSMIGTYNYVLFTNDTDFLQLNWAKYQLAMNYVYGKV
GPSGLLNVTGTRDWARWQQGFNNSEAQMILYHTLNTGAQLAEWAGDTTGLSSNWTARAKD
LAVAVNADCFDDAYGAFKDNATATTLYPQDANSMAILFGLVDQDRVQGISQRLTENWTPI
GAVAPELPENISPFISSFEIQAHFEAGQSDRALDLIRRSWGWYINNPNGTESTVIEGYLR
NATFGYRSSRGYDYDASYISHAHGWSAGPTSALINYVLGLSLTGRAGSTWRLAPQFGDLT
SVEGGFTSSLGRFQAAWSRESTKSSSYELSFKVPTGTQGTVVIPPVNGKGSKVTLNGKSV
KWGSEETKTISIMKGGSYRITVRSN

Enzyme Prediction     

EC	3.2.1.174:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	83	642	4.7e-98	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407469	Bac_rhamnosid6H	1.89e-11	204	526	4	303	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
379972	Bac_rhamnosid_C	2.24e-07	589	658	11	78	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA13216.1|GH78	0.0	1	685	1	685
QKX56673.1|GH78	0.0	4	683	4	691
UCK57529.1|GH78	0.0	15	682	17	685
ATZ56650.1|GH78	0.0	9	683	7	683
QRD88907.1|GH78	0.0	15	682	17	685

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	9.54e-21	150	604	262	663	Crystal structure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

PMAA_024050-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000209	0.999782	CS pos: 23-24. Pr: 0.9392

TMHMM  Annotations     

There is no transmembrane helices in PMAA_024050-t26_1-p1.