CAZyme Information: PMAA_023350-t26_1-p1

Basic Information

• Species: Talaromyces marneffei
• Lineage: Ascomycota; Eurotiomycetes; ; Trichocomaceae; Talaromyces; Talaromyces marneffei
• CAZyme ID: PMAA_023350-t26_1-p1
• CAZy Family: CE4
• CAZyme Description: D-lactate dehydrogenase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
574		64226.13	6.0407

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TmarneffeiATCC18224	10194	441960	145	10049

• Gene Location: location=DS995899:2170159-2172210(+)

Full Sequence      

MASTKLPVRYEDPEYQKTHTALFSNSTTRPLERTLPPGVTEADFQAAIKEFVAALGSEGV
LIGEALVDYIDPYELYEDISSERKVPSAAVLPRSVNELQEVLKTANKFGIPVWTFSRGKN
LGYGGPAPRVVGSIALDLHRMNKIIEVNEEFSYAVVEPGVTFTDLYEYCVKNKLSVWPSV
PSLGWGSVVGNTLDRGTGFTPTATHHQNICGLEVVLADGDIIRTGQFGISNSESAHLSKF
SFGPSIEGLFLQSNLGIVTKLGIWLFPQPPAFASCTLDVPNIEDIEQVVDLFHELRQSGV
IPNTIYVSSIAEWFSMKGQREEFWTEPGPIPAWRVKELQEELGLGYWIAKFGLYGPTKIV
EAQRDEIHRLIQQRIPTGRFNSSIFSGEHGRPLKAEDVPPEEGGFFVGIPSLWSLPMVKY
RLPLRGGGIGGHIDYSPIIPSSGKAVLEWIKISQKICEDNGFDLFCDFFMHERHIIFVNF
TTFDKTNLEHRSAIRKIFQGLFKDGKARGYSAYRTHVNFMDIIADFYDFNDHAYSRFVEK
IKDTLDPQGILSPGKQGIWGNRYRNSSLKITSVL

Enzyme Prediction     

No EC number prediction in PMAA_023350-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA4	33	566	1.5e-153	0.9904214559386973

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396238	FAD_binding_4	1.53e-32	86	225	1	139	FAD binding domain. This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase. One of the enzymes Vanillyl-alcohol oxidase (VAO) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110. The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment. VAO catalyzes the oxidation of a wide variety of substrates, ranging form aromatic amines to 4-alkylphenols. Other members of this family include D-lactate dehydrogenase, this enzyme catalyzes the conversion of D-lactate to pyruvate using FAD as a co-factor; mitomycin radical oxidase, this enzyme oxidizes the reduced form of mitomycins and is involved in mitomycin resistance. This family includes MurB an UDP-N-acetylenolpyruvoylglucosamine reductase enzyme EC:1.1.1.158. This enzyme is involved in the biosynthesis of peptidoglycan.
223354	GlcD	1.90e-31	50	556	1	455	FAD/FMN-containing dehydrogenase [Energy production and conversion].
178402	PLN02805	2.65e-14	85	288	133	327	D-lactate dehydrogenase [cytochrome]
183043	PRK11230	2.91e-12	72	302	43	261	glycolate oxidase subunit GlcD; Provisional
273751	FAD_lactone_ox	5.99e-05	92	222	21	147	sugar 1,4-lactone oxidases. This model represents a family of at least two different sugar 1,4 lactone oxidases, both involved in synthesizing ascorbic acid or a derivative. These include L-gulonolactone oxidase (EC 1.1.3.8) from rat and D-arabinono-1,4-lactone oxidase (EC 1.1.3.37) from Saccharomyces cerevisiae. Members are proposed to have the cofactor FAD covalently bound at a site specified by Prosite motif PS00862; OX2_COVAL_FAD; 1.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA13141.1|AA4	0.0	1	574	1	574
BCS27721.1|AA4	0.0	1	574	1	574
QRC93649.1|AA4	5.15e-287	10	566	6	561
CAE7177218.1|AA4	3.07e-286	10	568	7	564
BCS17805.1|AA4	2.64e-239	1	565	1	564

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5FXD_A	1.62e-113	31	568	1	526	Crystal structure of eugenol oxidase in complex with isoeugenol [Rhodococcus jostii RHA1],5FXD_B Crystal structure of eugenol oxidase in complex with isoeugenol [Rhodococcus jostii RHA1],5FXE_A Crystal structure of eugenol oxidase in complex with coniferyl alcohol [Rhodococcus jostii RHA1],5FXE_B Crystal structure of eugenol oxidase in complex with coniferyl alcohol [Rhodococcus jostii RHA1],5FXF_A Crystal structure of eugenol oxidase in complex with benzoate [Rhodococcus jostii RHA1],5FXF_B Crystal structure of eugenol oxidase in complex with benzoate [Rhodococcus jostii RHA1],5FXP_A Crystal structure of eugenol oxidase in complex with vanillin [Rhodococcus jostii RHA1],5FXP_B Crystal structure of eugenol oxidase in complex with vanillin [Rhodococcus jostii RHA1]
7PBG_A	6.47e-107	33	565	4	528	Chain A, FAD-binding oxidoreductase [Gulosibacter chungangensis],7PBG_B Chain B, FAD-binding oxidoreductase [Gulosibacter chungangensis],7PBI_A Chain A, FAD-binding oxidoreductase [Gulosibacter chungangensis],7PBI_B Chain B, FAD-binding oxidoreductase [Gulosibacter chungangensis],7PBI_C Chain C, FAD-binding oxidoreductase [Gulosibacter chungangensis],7PBI_D Chain D, FAD-binding oxidoreductase [Gulosibacter chungangensis],7PBI_E Chain E, FAD-binding oxidoreductase [Gulosibacter chungangensis],7PBI_F Chain F, FAD-binding oxidoreductase [Gulosibacter chungangensis],7PBI_G Chain G, FAD-binding oxidoreductase [Gulosibacter chungangensis],7PBI_H Chain H, FAD-binding oxidoreductase [Gulosibacter chungangensis]
1E0Y_A	3.12e-106	29	570	8	560	Structure of the D170S/T457E double mutant of vanillyl-alcohol oxidase [Penicillium simplicissimum],1E0Y_B Structure of the D170S/T457E double mutant of vanillyl-alcohol oxidase [Penicillium simplicissimum]
1DZN_A	8.72e-106	29	570	8	560	Asp170Ser mutant of vanillyl-alcohol oxidase [Penicillium simplicissimum],1DZN_B Asp170Ser mutant of vanillyl-alcohol oxidase [Penicillium simplicissimum]
1W1K_A	1.23e-105	29	570	8	560	STRUCTURE OF THE OCTAMERIC FLAVOENZYME VANILLYL-ALCOHOL OXIDASE: Ile238Thr Mutant [Penicillium simplicissimum],1W1K_B STRUCTURE OF THE OCTAMERIC FLAVOENZYME VANILLYL-ALCOHOL OXIDASE: Ile238Thr Mutant [Penicillium simplicissimum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P56216|VAOX_PENSI	1.76e-104	29	570	8	560	Vanillyl-alcohol oxidase OS=Penicillium simplicissimum OX=69488 GN=VAOA PE=1 SV=1
sp|P09788|DH4C_PSEPU	7.26e-99	35	558	9	515	4-cresol dehydrogenase [hydroxylating] flavoprotein subunit OS=Pseudomonas putida OX=303 GN=pchF PE=1 SV=3
sp|P9WIT0|Y2280_MYCTO	2.08e-20	51	305	8	248	Uncharacterized FAD-linked oxidoreductase MT2338 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT2338 PE=3 SV=1
sp|P9WIT1|Y2280_MYCTU	2.08e-20	51	305	8	248	Uncharacterized FAD-linked oxidoreductase Rv2280 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv2280 PE=1 SV=1
sp|F1QXM5|LDHD_DANRE	3.52e-19	42	300	30	275	Probable D-lactate dehydrogenase, mitochondrial OS=Danio rerio OX=7955 GN=ldhd PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000041	0.000006

TMHMM  Annotations     

There is no transmembrane helices in PMAA_023350-t26_1-p1.