CAZyme Information: PMAA_022750-t26_1-p1

Basic Information

• Species: Talaromyces marneffei
• Lineage: Ascomycota; Eurotiomycetes; ; Trichocomaceae; Talaromyces; Talaromyces marneffei
• CAZyme ID: PMAA_022750-t26_1-p1
• CAZy Family: CE4
• CAZyme Description: glycosyl hydrolase family 88, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
371		42312.43	6.4323

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TmarneffeiATCC18224	10194	441960	145	10049

• Gene Location: location=DS995899:1999145-2000260(-)

Full Sequence      

MAVTKPTAADVHSAIRLLIDNLVNIKDETGKFLLYLEDGRVIDTKSWAGWEWTHGIGLYG
VWKYYEMTGHESLLKIIEDWFAARFAEGGTTKNINTMVVFLTLAYVYEKTGNVAYLPWLD
SWAEWAMYELPRTKYGGMQHITYNSINTEQLWDDTLMMTVLPLAKIGKLLGRPEYVTEAK
KQFLIHIKYLFDTRTGLFFHGWKFEGENGGHNFAQARWARGNSWLTIVIPEILELLEFDV
SDPIRLHLIHTLDAQCGALKKFQHSSGYWRTLIDQADDGSYVEASATAGFAYGMLKGQRK
RYIGSQYRETAEKAVKAVLSAIDSNGELQNTSFGTAMGHNLDFYREIPITSMPYGQAMAI
MALVEYLRTYI

Enzyme Prediction     

No EC number prediction in PMAA_022750-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	44	368	3.3e-108	0.9789156626506024

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226678	YesR	2.72e-112	21	370	7	357	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
400034	Glyco_hydro_88	9.28e-105	24	370	1	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA13083.1|GH105	1.15e-281	1	371	1	371
QKX63029.1|GH105	1.54e-233	1	371	1	369
BBO93662.1|GH105	2.12e-212	1	368	1	364
CAP80991.1|GH105	2.12e-212	1	368	1	364
QQK40818.1|GH105	1.06e-205	1	368	1	364

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XUV_A	1.34e-173	7	371	4	373	Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]
3QWT_A	4.07e-165	10	370	25	380	Chain A, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	2.29e-162	9	370	25	381	Chain A, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
4WU0_A	4.36e-20	50	320	23	300	Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O31521|URHG1_BACSU	2.24e-49	50	369	29	338	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1
sp|P9WF04|UH105_ALTSL	1.36e-12	152	328	201	375	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
sp|P0A3U6|PIC1_AGRFC	8.88e-09	167	322	10	166	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
sp|P0A3U7|PIC1_RHIRD	8.88e-09	167	322	10	166	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000069	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PMAA_022750-t26_1-p1.