CAZyme Information: PMAA_022660-t26_1-p1

Basic Information

• Species: Talaromyces marneffei
• Lineage: Ascomycota; Eurotiomycetes; ; Trichocomaceae; Talaromyces; Talaromyces marneffei
• CAZyme ID: PMAA_022660-t26_1-p1
• CAZy Family: GT62
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
500	DS995899|CGC9	58261.55	6.5008

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TmarneffeiATCC18224	10194	441960	145	10049

• Gene Location: location=DS995899:1967359-1968920(-)

Full Sequence      

MRLIRRQYLGLVPVVTLFFIFGTIYSTHRWVSIQQLNKDRWSQRPGDQETQQFHDGQNYN
DPNCAVFPRNRLRDIQIVLRIGSTQPFDQISSHINNITNCISNLIVVSDRVEEIGNGFWS
HDIIADLPKVYWEGIDKDSLDGTDQTAGLKAYENINKGDSSWKQGKHASDRLTHRQGWLL
DRFKFLPMVEYAYNVNPQAKWFYFIEADTYVVWDTLFRLLDRYDFQQEWYMGSPSPGREL
DGEKTWFAYGGNGFILSRTAIQRLVSKNLVKFDESTNTNRTELSLTERWADLVRSDCCGD
SVLGFALADKGIFLSGLYPIFNPHPLHGIPFGPSGKPYWCQPVLSLHKTWPREVPGLTDF
VKDHTSKRPLIYADLFDYLNLQEVKQRDDWQNSDWNSFEEAPESPVHETIEACAEGCHAH
GECFQWTYWVEASWKWKTVPKKKCTFVRSIRLGTHKDREESWTTTAVWTSGWDVEKISKW
TKENPCGKPEWVEPSLQRIY

Enzyme Prediction     

No EC number prediction in PMAA_022660-t26_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
367085	Fringe	1.38e-10	189	264	75	159	Fringe-like. The drosophila protein fringe (FNG) is a glucosaminyltransferase that controls the response of the Notch receptor to specific ligands. FNG is localized to the Golgi apparatus (not secreted as previously thought). Modification of Notch occurs through glycosylation by FNG. The xenopus homolog, lunatic fringe, has been implicated in a variety of functions.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA13073.1|GT31	0.0	1	500	1	500
QKX64723.1|GT31	2.99e-204	2	500	3	478
BCS10791.1|GT31	5.54e-126	60	500	82	481
BCR98451.1|GT31	5.54e-126	60	500	82	481
BCR85810.1|GT31	1.14e-123	61	500	89	485

PDB Hits     

PMAA_022660-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q6KFX9|RFNG_DANRE	2.04e-06	189	258	166	246	Beta-1,3-N-acetylglucosaminyltransferase radical fringe OS=Danio rerio OX=7955 GN=rfng PE=2 SV=1
sp|Q8JHF2|LFNG_DANRE	6.56e-06	189	258	178	258	Beta-1,3-N-acetylglucosaminyltransferase lunatic fringe OS=Danio rerio OX=7955 GN=lfng PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.972763	0.027255

TMHMM  Annotations     

Start	End
9	31