CAZyme Information: PMAA_018740-t26_1-p1

Basic Information

• Species: Talaromyces marneffei
• Lineage: Ascomycota; Eurotiomycetes; ; Trichocomaceae; Talaromyces; Talaromyces marneffei
• CAZyme ID: PMAA_018740-t26_1-p1
• CAZy Family: GT71
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
545		60870.77	5.6074

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TmarneffeiATCC18224	10194	441960	145	10049

• Gene Location: location=DS995899:905998-907635(+)

Full Sequence      

MTSPKSSFSAGPVLKMPLFRLKTLFPLVALLSIGFFFWCIDRYDRAALSKIKHPIEQLSN
TANTITSNKSPPAQVQLPPTHNSFGNCEFDTASAPPLPFGEWLTRKNFTRAFIRPNKVSA
QTQFRSLEDINTPVLPPFRALERGLILSDENNDKTVPCPTVAEVNVAMDHDVEETSKLLF
GLATTVDRLERLLPSLLYSFAGTKASLLVLVPESDDNLSAQEAYFRSRGLDITLESSPLE
FTARYFGLVEAFSLHIKQKRPQTEWVGFIDDDTFFPSLPSVALQLKAADSSKKHYIGSLS
EASWQVDTWGHMAFGGGGIFVSKPLLDILMESYDECQSWGEQPGDQKLGQCIERSSNTPL
TLWPSLHQMDLTGAPDGILESGLPIDSLHHWSTWYTKDVVKMGAVAAAAGKRSVLRRWVF
DQQEFVDQSTGESYRTFWILTNGHSVVRYTLMPGTPNDAINFDHVEKTWEEDMAGYTQRF
GAMREKDQDGVIKERYLLTDAIVIGDNVHQFYTREEHTSHSLIEIVWLGSKSGSGANAGS
SRNTN

Enzyme Prediction     

EC	2.4.1.-:2

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
215605	PLN03153	1.05e-11	248	417	200	375	hypothetical protein; Provisional
398362	DUF604	5.26e-07	312	390	9	90	Protein of unknown function, DUF604. This family includes a conserved region found in several uncharacterized plant proteins.
367085	Fringe	7.42e-05	264	403	86	237	Fringe-like. The drosophila protein fringe (FNG) is a glucosaminyltransferase that controls the response of the Notch receptor to specific ligands. FNG is localized to the Golgi apparatus (not secreted as previously thought). Modification of Notch occurs through glycosylation by FNG. The xenopus homolog, lunatic fringe, has been implicated in a variety of functions.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA12680.1|GT31	0.0	16	545	1	530
QKX57029.1|GT31	2.15e-283	16	536	1	521
BAE62723.1|GT31	1.09e-261	6	536	5	526
QRD84523.1|GT31	1.09e-261	6	536	5	526
UDD58055.1|GT31	1.09e-261	6	536	5	526

PDB Hits     

PMAA_018740-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

PMAA_018740-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999997	0.000012

TMHMM  Annotations     

Start	End
21	40