CAZyme Information: PMAA_017300-t26_1-p1

Basic Information

• Species: Talaromyces marneffei
• Lineage: Ascomycota; Eurotiomycetes; ; Trichocomaceae; Talaromyces; Talaromyces marneffei
• CAZyme ID: PMAA_017300-t26_1-p1
• CAZy Family: CBM48
• CAZyme Description: beta-N-acetylglucosaminidase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
877	DS995899|CGC26	96541.44	6.3667

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TmarneffeiATCC18224	10194	441960	145	10049

• Gene Location: location=DS995899:538103-540964(+)

Full Sequence      

MSSDNESGLRRKVGQLFAVGFHGFTSSPEIRTLIRDYGLGAVILFRRNIKDATQLQALTL
ALQQEAKDAGHEHPLFIGIDQEHGLVTRITPQTAAQQPGQMTLGATQSADNAYKIGKCTG
EMLSFFGINMNYAPVCDVNSEPLNPVIGVRSFGDNPNFVAKMSSATARGLRETGVVPTVK
HFPGHGDTAVDSHHGLPVINKSRSELERCELIPFRRSVAEGIEAVMTAHIALPRISSGPE
SNRLPATLSPEALGILRNDMKYDGVIVTDCLEMNGIRGTYGTVDGTLMSLKAGSDSVMIC
HTYAVQVTSIERVVQAVKSGELPESRICEALRRITSLKERFLSWEYALRSTDKLSLDELH
AMNEKHQQIATKVYSQSTTVIRNSLKVLPVSGTLSKVLLLTPGGKMPAGGAVDDGGPNHK
TYIDVLQHAVGNTSSSITRINYPDTGELAEEHWKMIEIDADIVILTSINAKEAEGQRNFA
LEVAKRRKDVIAIATCNPYDFLDDDELFKTYVATYEPTVEAFASAIDVIFGRAPAMGTLP
VASTLNSKRDAHHEVLTLDESQNDSMIDGILNIWNAALPDYPLPAENLRKVINQPHGHHF
IARDTQTKIIIGFCLSYTSQNEGQTSAEIAVIAVHPSKRHQGIGTELLATTREYLYENYG
CKNTSLRSYFPRFWPGLPVDLTPETEQFFVHSGFRFTRGGDSDLYQDIRNFVSPHEYIDK
AVAVGVKYKAIETPEEFENCLVGQKRNFSHYTGWVEAFTSLHPSKHPRSIMAGFNQSTGT
QIAWTLMLSPDDDFVSQNWAFPPLASGSLALKTGIIGCVGVDQAHRSRGVGLALLCHAIE
DMKQRGVEAVFVDSTDIVDWYAKVGFGRWKEYIRAEI

Enzyme Prediction     

EC	3.2.1.52:8

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	71	298	5.4e-57	0.9629629629629629

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	6.06e-93	9	417	3	377	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
395747	Glyco_hydro_3	1.19e-87	9	337	2	316	Glycosyl hydrolase family 3 N terminal domain.
235417	PRK05337	5.60e-48	23	301	10	281	beta-hexosaminidase; Provisional
185053	PRK15098	2.10e-09	9	397	47	416	beta-glucosidase BglX.
223532	RimI	1.92e-08	547	666	4	131	Ribosomal protein S18 acetylase RimI and related acetyltransferases [Translation, ribosomal structure and biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA12539.1|GH3	0.0	1	877	1	877
QKX56918.1|GH3	0.0	9	877	7	854
BCR85716.1|GH3	0.0	9	872	6	849
CAP94355.1|GH3	0.0	9	877	6	852
QQK41162.1|GH3	1.34e-317	7	872	4	847

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZM6_A	2.91e-140	1	872	1	853	A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432],4ZM6_B A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432]
6K5J_A	1.81e-95	9	545	13	533	Structure of a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
3BMX_A	1.79e-72	5	541	40	615	Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	5.15e-72	5	541	14	589	Chain A, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	1.02e-71	5	541	44	619	Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P40406|NAGZ_BACSU	9.22e-72	5	541	40	615	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
sp|P48823|HEXA_PSEO7	6.32e-61	25	402	50	437	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
sp|L7N6B0|LPQI_MYCTU	3.16e-39	10	338	62	380	Beta-hexosaminidase LpqI OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=lpqI PE=1 SV=1
sp|A0A0H3M1P5|LPQI_MYCBP	7.88e-39	10	338	62	380	Beta-hexosaminidase LpqI OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) OX=410289 GN=lpqI PE=3 SV=1
sp|A9M1Z4|NAGZ_NEIM0	1.26e-37	24	301	18	290	Beta-hexosaminidase OS=Neisseria meningitidis serogroup C (strain 053442) OX=374833 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000045	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PMAA_017300-t26_1-p1.