CAZyme Information: PMAA_015610-t26_1-p1

Basic Information

• Species: Talaromyces marneffei
• Lineage: Ascomycota; Eurotiomycetes; ; Trichocomaceae; Talaromyces; Talaromyces marneffei
• CAZyme ID: PMAA_015610-t26_1-p1
• CAZy Family: AA7
• CAZyme Description: acetylxylan esterase 2 precursor, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
224	DS995899|CGC30	22749.37	4.2430

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TmarneffeiATCC18224	10194	441960	145	10049

• Gene Location: location=DS995899:90122-90923(+)

Full Sequence      

MRTSFLALVLTAVASAAPVALDSRTTCHSGVYVIGVRGTSESAGYGSVGSVVSSVLAAIP
GSAGVALDYPASWLDPLYPDSVTDGINTLISLVKNYADNCSGNIVLVGFSQGANVITDAL
AGGVAKPTPLAASYIDQISAITVFGDPSFTHGQSFDVGTDTSSNGIFSRGGDSLALLNTY
AGKIRSYCDAGDVYCASGDVSSVHGQEVPTWGSDAVRFIVSMST

Enzyme Prediction     

No EC number prediction in PMAA_015610-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE5	30	221	1.2e-36	0.9682539682539683

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395860	Cutinase	3.96e-31	27	221	1	171	Cutinase.
369775	PE-PPE	4.17e-06	60	148	1	90	PE-PPE domain. This domain is found C terminal to the PE (pfam00934) and PPE (pfam00823) domains. The secondary structure of this domain is predicted to be a mixture of alpha helices and beta strands.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA12369.1|CE5	1.18e-148	1	224	1	224
BAQ59098.1|CE5	1.64e-123	1	224	1	224
AQA29314.1|CE5	2.15e-55	2	221	3	228
UJO24861.1|CE5	2.15e-55	2	221	3	228
UJO25079.1|CE5	5.33e-49	8	223	7	224

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1BS9_A	5.34e-26	31	221	5	204	Acetylxylan Esterase From P. Purpurogenum Refined At 1.10 Angstroms [Talaromyces purpureogenus]
1G66_A	5.34e-26	31	221	5	204	ACETYLXYLAN ESTERASE AT 0.90 ANGSTROM RESOLUTION [Talaromyces purpureogenus]
2AXE_A	5.34e-26	31	221	5	204	Iodinated Complex Of Acetyl Xylan Esterase At 1.80 Angstroms [Talaromyces purpureogenus]
1QOZ_A	8.04e-25	31	221	5	204	Chain A, ACETYL XYLAN ESTERASE [Trichoderma reesei],1QOZ_B Chain B, ACETYL XYLAN ESTERASE [Trichoderma reesei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O59893|AXE2_TALPU	5.06e-25	31	221	32	231	Acetylxylan esterase 2 OS=Talaromyces purpureogenus OX=1266744 GN=axe-2 PE=1 SV=1
sp|A0A2J8C362|CUTI1_VERDA	1.70e-23	1	221	1	227	Cutinase 11 OS=Verticillium dahliae OX=27337 GN=VD0003_g7577 PE=1 SV=1
sp|Q99034|AXE1_HYPJE	2.66e-23	31	221	36	235	Acetylxylan esterase OS=Hypocrea jecorina OX=51453 GN=axe1 PE=1 SV=1
sp|P0A537|CULP3_MYCBO	4.73e-10	37	220	53	223	Probable carboxylesterase Culp3 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) OX=233413 GN=cut3 PE=3 SV=1
sp|P9WP38|CULP3_MYCTO	4.73e-10	37	220	53	223	Probable carboxylesterase Culp3 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=cut3 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000282	0.999691	CS pos: 24-25. Pr: 0.7574

TMHMM  Annotations     

There is no transmembrane helices in PMAA_015610-t26_1-p1.