CAZyme Information: PMAA_015570-t26_1-p1

Basic Information

• Species: Talaromyces marneffei
• Lineage: Ascomycota; Eurotiomycetes; ; Trichocomaceae; Talaromyces; Talaromyces marneffei
• CAZyme ID: PMAA_015570-t26_1-p1
• CAZy Family: AA7
• CAZyme Description: mannosyl phosphorylinositol ceramide synthase CSH1, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
336		38879.77	7.5233

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TmarneffeiATCC18224	10194	441960	145	10049

• Gene Location: location=DS995899:75577-76780(+)

Full Sequence      

MAGHRWHRRLLTTVAGFAGVVIAIYAATRIVAFVELFGIFKDHAGVRNTQAEIAAYYNSS
SSDSRSPMVPKIIHQVFHNWHDENNDTIPAKWQPSRQSCLDLNPDWEQMLWSAKRSEEFI
EKEYPWFLSAYKSYKYPVQRVDVIKYFVLHHYGGIYIDLDNGCTANLEPLTYYPAFTTDG
GLGALSNNIMGGTPEHPFFVIITENLIRWKLNYLLPYVTVMLCSGQWFLTAMWEKYHSDL
SPDSTVRGFANAKIGWKPLHRILMDMRPGADPWVFFNQVAGESWADWDYRILKAIGDHIV
LIILLVVVFICVLVRFCMNYRARSRATYIEYQKLDI

Enzyme Prediction     

No EC number prediction in PMAA_015570-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	91	171	4.8e-20	0.9444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	1.29e-40	67	247	80	254	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	4.08e-20	89	170	1	86	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA12364.1|GT32	3.04e-257	1	336	1	336
QBZ58620.1|GT32	1.49e-121	9	299	9	304
UNI16793.1|GT32	4.70e-104	19	304	23	293
AEO56548.1|GT32	9.32e-100	25	301	22	302
CDP25656.1|GT32	5.90e-97	25	302	22	296

PDB Hits     

PMAA_015570-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P38287|CSH1_YEAST	5.44e-57	57	299	50	274	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|P33300|SUR1_YEAST	2.69e-55	68	299	54	266	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|Q10323|IMT3_SCHPO	7.03e-52	57	288	45	258	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	4.11e-51	58	303	71	300	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|O14084|IMT1_SCHPO	2.91e-36	58	291	53	268	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999961	0.000080

TMHMM  Annotations     

Start	End
10	32
211	233
294	316