CAZyme Information: PMAA_014620-t26_1-p1

Basic Information

• Species: Talaromyces marneffei
• Lineage: Ascomycota; Eurotiomycetes; ; Trichocomaceae; Talaromyces; Talaromyces marneffei
• CAZyme ID: PMAA_014620-t26_1-p1
• CAZy Family: AA7
• CAZyme Description: arabinogalactan endo-1,4-beta-galactosidase GalA

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
353		38450.33	5.2888

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TmarneffeiATCC18224	10194	441960	145	10049

• Gene Location: location=DS995906:1651321-1652462(-)

Full Sequence      

MRPSILLSSLATFASLASATLRYRGADISSLLVEENNHISYKNTNGAGAKLETILASNGV
NTVRQRLWVNPSDGVYGLDYNRQLAARMVNAGMKIYLDMHFSDTWADPSHQTTPSGWSTT
DIGTLSWQLYNYTMDVCNSFAEQNIPLEIVSIGNEIRAGLLWPLGSTSNYHNIATLLHSA
AWGIKDSKLATKPKIMIHLDNGWSWSEQSYFYNTVLAEGPLLKTDFDLMGVSYYPFYTSS
ATLASLKSTLANMASTWGKGLIVAETNWPFACPRPAYAFPSDLTSIPFSAAGQATFLKDV
ASIVAGTSNGLGMFYWEPAWIGNAGLGSSCSDNLLVDSSTDAFRTSVEVFSSI

Enzyme Prediction     

EC	3.2.1.89:16

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH53	23	347	1.5e-94	0.9883040935672515

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
311610	Glyco_hydro_53	2.44e-129	23	350	1	333	Glycosyl hydrolase family 53. This domain belongs to family 53 of the glycosyl hydrolase classification. These enzymes are enzymes are endo-1,4- beta-galactanases (EC:3.2.1.89). The structure of this domain is known and has a TIM barrel fold.
226385	GanB	7.73e-67	24	321	41	345	Arabinogalactan endo-1,4-beta-galactosidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA22233.1|GH53	7.53e-262	1	353	1	353
EED12184.1|GH53|3.2.1.89	4.93e-226	9	353	9	353
AIZ09171.1|GH53|3.2.1.89	1.05e-218	21	353	3	335
QKX57828.1|GH53	2.30e-192	10	351	324	665
AAA32692.1|GH53|3.2.1.89	1.91e-176	10	353	7	350

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1FHL_A	1.23e-176	21	353	2	334	Crystal Structure Of Beta-1,4-galactanase From Aspergillus Aculeatus At 293k [Aspergillus aculeatus],1FOB_A Crystal Structure Of Beta-1,4-galactanase From Aspergillus Aculeatus At 100k [Aspergillus aculeatus],6Q3R_A ASPERGILLUS ACULEATUS GALACTANASE [Aspergillus aculeatus],6Q3R_B ASPERGILLUS ACULEATUS GALACTANASE [Aspergillus aculeatus]
4BF7_A	2.43e-164	5	353	1	350	Emericilla nidulans endo-beta-1,4-galactanase [Aspergillus nidulans]
1HJS_A	1.22e-152	21	353	2	332	Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_B Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_C Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_D Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_A Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_B Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_C Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_D Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus]
1HJQ_A	1.90e-149	21	353	2	332	Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Humicola insolens]
1R8L_A	1.52e-37	24	321	26	325	The structure of endo-beta-1,4-galactanase from Bacillus licheniformis [Bacillus licheniformis],1R8L_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis [Bacillus licheniformis],1UR0_A The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR0_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR4_A The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR4_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],2CCR_A Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2CCR_B Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2J74_A Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2J74_B Structure of Beta-1,4-Galactanase [Bacillus licheniformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P48842|GANA_ASPAC	3.39e-177	10	353	7	350	Arabinogalactan endo-beta-1,4-galactanase OS=Aspergillus aculeatus OX=5053 GN=gal1 PE=1 SV=1
sp|Q9Y7F8|GANA_ASPTU	6.84e-177	10	353	7	350	Probable arabinogalactan endo-beta-1,4-galactanase A OS=Aspergillus tubingensis OX=5068 GN=galA PE=2 SV=1
sp|A2RB93|GANA_ASPNC	2.27e-175	4	353	4	350	Probable arabinogalactan endo-beta-1,4-galactanase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=galA PE=3 SV=1
sp|Q8X168|GANA_ASPNG	9.22e-175	10	353	7	350	Arabinogalactan endo-beta-1,4-galactanase A OS=Aspergillus niger OX=5061 GN=galA PE=1 SV=1
sp|Q4WJ80|GANA_ASPFU	7.25e-171	15	353	17	356	Probable arabinogalactan endo-beta-1,4-galactanase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=galA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000441	0.999532	CS pos: 24-25. Pr: 0.8166

TMHMM  Annotations     

There is no transmembrane helices in PMAA_014620-t26_1-p1.