CAZyme Information: PMAA_012270-t26_1-p1

Basic Information

• Species: Talaromyces marneffei
• Lineage: Ascomycota; Eurotiomycetes; ; Trichocomaceae; Talaromyces; Talaromyces marneffei
• CAZyme ID: PMAA_012270-t26_1-p1
• CAZy Family: AA7
• CAZyme Description: MIPC synthase subunit (SurA), putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
351	DS995906|CGC14	40792.08	8.0566

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TmarneffeiATCC18224	10194	441960	145	10049

• Gene Location: location=DS995906:1057208-1058428(-)

Full Sequence      

MRRGVVIFILVNVLIISFLVRSVFTLLTLLIEDASADAIHRSEIPSPNSSLIESRPQLIP
KIIHQTYINESIPERWIEPQRSCIDLHPDYEYILWTNEKSREFIAAEYPWFLETFDGYTY
PIQRADAIRYFVLAHYGGVYLDLDDGCHRRLDPLLSYPAWVRRTKPTGISNDAMGSVPQH
HFFLKVVESLQAYDRHWVLPYITVMYSTGPLFLSVIWKEYMPRSVGMDRVRVLMPEEYNG
FSWSFFTHNVGNSWHGADAQLIFWMCRYWVLLTVAGFTIAGCVGFCMWIVYGRLLLLGHR
YRYSRIASGSISAPKIRRRPFTIMPSFFRRISASSISSDEELGRKEGAYSE

Enzyme Prediction     

EC	2.4.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	76	155	2.3e-22	0.9333333333333333

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	3.09e-74	5	277	14	303	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	4.33e-28	73	157	1	89	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA21998.1|GT32	1.58e-262	1	351	1	351
QKX60032.1|GT32	1.12e-199	1	349	1	344
EAA57874.1|GT32	7.79e-186	1	349	1	348
AAP47108.1|GT32	7.79e-186	1	349	1	348
QMW44769.1|GT32	2.49e-185	1	343	1	344

PDB Hits     

PMAA_012270-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P38287|CSH1_YEAST	4.10e-103	1	309	1	302	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|P33300|SUR1_YEAST	2.27e-101	1	339	1	331	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|Q10323|IMT3_SCHPO	4.23e-87	48	277	46	277	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	2.18e-84	37	279	56	306	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|O14084|IMT1_SCHPO	1.75e-54	59	306	64	314	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.329025	0.670946	CS pos: 36-37. Pr: 0.4528

TMHMM  Annotations     

Start	End
5	27
198	217
269	291