CAZyme Information: PMAA_010770-t26_1-p1

Basic Information

• Species: Talaromyces marneffei
• Lineage: Ascomycota; Eurotiomycetes; ; Trichocomaceae; Talaromyces; Talaromyces marneffei
• CAZyme ID: PMAA_010770-t26_1-p1
• CAZy Family: AA7
• CAZyme Description: ER glycosyl hydrolase (Edem), putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1148		128468.47	5.9152

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TmarneffeiATCC18224	10194	441960	145	10049

• Gene Location: location=DS995906:634889-638531(+)

Full Sequence      

MRTRCHGPNIPGLPSACLRWVLLLLALWLDQVQAMKNNEIRDLRLQTEQMFYHGYDNYIK
YAFPEDELRPLTCGPLTRDRDHPERIELNDVLGNYSLTMIDSLSTLGILASSNDTGSRAW
SYFENSVQEIVRLYGDGSQGPEGQGERARGFDLDSKVQVFETVIRGLGGLLSAHLFAVGD
LPIRGYNPSTEATEYAKAWNKSGFSASKNSKGIVWSNGFIYNGQLLRLARDLADRLLPAF
YTPTGLPYPRVNLRYGVTFYDNSPLSKGYPGQKTDDRKKYTTRYQSRPEVTETCSAGAGS
LVLEFTTLSRLTGDGRYEDLAKRAFWAVWLRRSEIDLIGAGIDAETGNWVAPFTGIGAGI
DSFFEYAFKAYVLLSTGEPPEFDTGSPWSIMDNYFIPLEQAHHSPEFYLQVWQDAQDAIK
HHLYRGHGYQHPHYVQGDLQTGATRAFWIDSLSAFYPGVLTLAGRIEEATEIHLLATALW
TRFSALPERWNVATGEIDNDLGWWGGRPEFIESTYYLYRATKDPWYLHVGEMVLRDIKRR
CWTRCGWAGLQDVRTGELQDRMESFFLGETAKYMFLLFDQDHPLNNLEAPFVFTTEGHPL
IIPKSGPKTSSSTHDSNSEQVVAEVCEVAPVPPPFSFSSTAARPDIFHAASLARLHLMPG
RNEVGGALFGFAHDHPSVTVSDLFSPSNYTFYPWTLPSELVPYNAMSSPMSIRPTLDISF
PKLPGMIVGSGSMERVQDGVFLKSIGGMRLGMVQDMPLRIDDDSAGVYTDLFRIQVINNV
PLGRDEKVYLSRELVFDVLSPNDPHFSRVRDPIILDIVIDVEPESTRTKNKNHTKASRHQ
THNQEPAIIQQESTAFSDKETLLKGRISPASSVRTALSALMDHISTMLSDDNSNDLDNDN
ENGYYGSVQSSLFKKRPSSGVPTTRLVLPAINSVGAGSAPIPDIADAAVFSHTGKPSATR
LTWSKIYLTDELCDHRLPADVPREYQVLIVKRGGCSFTEKLKNIPGYPNSGSSNNNNNHL
QLVIVVSYPEHDAGPSSSFYHDDGKTFQASDEQNFYEERYYHRPFTSTNPQQMQARAALA
SEGMLVRPHLDEIQTTSSGLPRREPISMIMVGGGEETYELLRNSTGLGIRRRYVVKSQDV
PIGNLYII

Enzyme Prediction     

No EC number prediction in PMAA_010770-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH47	50	601	4.3e-143	0.9955156950672646

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396217	Glyco_hydro_47	3.31e-135	50	602	1	453	Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2).
240427	PTZ00470	4.70e-58	36	604	67	520	glycoside hydrolase family 47 protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA21863.1|GH47	0.0	1	1148	1	1149
QKX55008.1|GH47	0.0	44	1148	382	1642
BCS05200.1|GH47	0.0	1	1148	1	1096
BCS16758.1|GH47	0.0	1	1148	1	1096
QMW34129.1|GH47	0.0	1	1148	1	1090

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5KIJ_A	5.74e-33	50	602	12	451	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase and Man9GlcNAc2-PA complex [Homo sapiens]
1FMI_A	6.31e-33	50	602	17	456	Crystal Structure Of Human Class I Alpha1,2-Mannosidase [Homo sapiens]
1FO2_A	6.51e-33	50	602	17	456	Crystal Structure Of Human Class I Alpha1,2-Mannosidase In Complex With 1-Deoxymannojirimycin [Homo sapiens],1FO3_A Crystal Structure Of Human Class I Alpha1,2-Mannosidase In Complex With Kifunensine [Homo sapiens]
4AYO_A	7.13e-33	43	578	13	413	Structure of The GH47 processing alpha-1,2-mannosidase from Caulobacter strain K31 [Caulobacter sp. K31],4AYP_A Structure of The GH47 processing alpha-1,2-mannosidase from Caulobacter strain K31 in complex with thiomannobioside [Caulobacter sp. K31],4AYQ_A Structure of The GH47 processing alpha-1,2-mannosidase from Caulobacter strain K31 in complex with mannoimidazole [Caulobacter sp. K31],4AYR_A Structure of The GH47 processing alpha-1,2-mannosidase from Caulobacter strain K31 in complex with noeuromycin [Caulobacter sp. K31],5MEH_A Crystal structure of alpha-1,2-mannosidase from Caulobacter K31 strain in complex with 1-deoxymannojirimycin [Caulobacter sp. K31],5NE5_A Crystal structure of family 47 alpha-1,2-mannosidase from Caulobacter K31 strain in complex with kifunensine [Caulobacter sp. K31]
1X9D_A	1.87e-32	50	602	95	534	Crystal Structure Of Human Class I alpha-1,2-Mannosidase In Complex With Thio-Disaccharide Substrate Analogue [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O94726|MNL1_SCHPO	2.56e-122	22	754	12	589	ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mnl1 PE=3 SV=2
sp|P38888|MNL1_YEAST	4.40e-104	17	619	3	526	ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNL1 PE=1 SV=1
sp|Q92611|EDEM1_HUMAN	1.32e-103	39	598	129	582	ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Homo sapiens OX=9606 GN=EDEM1 PE=1 SV=1
sp|Q925U4|EDEM1_MOUSE	1.61e-103	39	604	124	583	ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Mus musculus OX=10090 GN=Edem1 PE=1 SV=1
sp|Q9SXC9|MNS5_ARATH	7.68e-91	41	618	35	494	Alpha-mannosidase I MNS5 OS=Arabidopsis thaliana OX=3702 GN=MNS5 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000281	0.999684	CS pos: 34-35. Pr: 0.9729

TMHMM  Annotations     

There is no transmembrane helices in PMAA_010770-t26_1-p1.