CAZyme Information: PMAA_009960-t26_1-p1

Basic Information

• Species: Talaromyces marneffei
• Lineage: Ascomycota; Eurotiomycetes; ; Trichocomaceae; Talaromyces; Talaromyces marneffei
• CAZyme ID: PMAA_009960-t26_1-p1
• CAZy Family: AA6
• CAZyme Description: exo-beta-1,3-glucanase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
556	DS995906|CGC10	58091.84	6.2270

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TmarneffeiATCC18224	10194	441960	145	10049

• Gene Location: location=DS995906:411543-413382(+)

Full Sequence      

MAKLLGLLLALPFLARALPADTLAARADHSSNDPTFNVSQFVSNDSYKPHKTGIPFTLLD
TSIQPWAKLNQPLKTEAVANIDAATTCTPLAASNPSTWWYESIAHNGLSSFMSSNYRSNY
AVFRNVVTDYGADNTGATDASKAIQNAINAGPSNGGPVRGSGNYGTTGQPAVVYLPAGTY
LMSKNIQLLVGTVLVGDPINPPTLKATSSFPNDHIVYAKDPNYGGTINFYIGIKNIIIDS
TAVNGATNIALLDWTVSQATQLSNVVFNMPDYSTGHVGVTSQYDSNSNIILNDLTFNGGA
YGLKLSGQQWILKNIKTSGTTTGISAGGFSVVCQACSFEYAATGIDATGVSGTTTVIDSS
GLNLGVFLKGTNSGGAVNSVVLENVSYDGTTVSMSGSTVLSGSVTDTWVYGHLYSSGSSS
SSPVTGRTVTTPRSSSLLSNGRYFITEKPLTFQEYSINQVLNIKSVAGLPVYGDGSTDDT
ANINSILSKYAGCKVIYFPAGTYIVTNTIFIPAGSRIYGDAYGTAISAIGSNYYNPNAPG
TMVRVGNSGDVGVANC

Enzyme Prediction     

No EC number prediction in PMAA_009960-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH55	90	554	7.2e-119	0.6256756756756757

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
403800	Pectate_lyase_3	3.05e-62	123	346	1	213	Pectate lyase superfamily protein. This family of proteins possesses a beta helical structure like Pectate lyase. This family is most closely related to glycosyl hydrolase family 28.
403800	Pectate_lyase_3	2.23e-06	473	526	11	67	Pectate lyase superfamily protein. This family of proteins possesses a beta helical structure like Pectate lyase. This family is most closely related to glycosyl hydrolase family 28.
227721	Pgu1	7.03e-04	126	181	84	125	Polygalacturonase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA21782.1|GH55	0.0	1	554	1	554
QKX55086.1|GH55	9.66e-211	83	554	39	509
EAA60087.1|GH55	6.04e-189	49	554	151	648
BCS06656.1|GH55	3.24e-186	46	554	47	551
BCR94046.1|GH55	3.24e-186	46	554	47	551

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3EQN_A	7.90e-62	76	553	1	489	Chain A, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQN_B Chain B, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQO_A Chain A, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQO_B Chain B, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium]
5M5Z_A	3.01e-45	95	552	3	472	Chain A, Beta-1,3-glucanase [Thermochaetoides thermophila],5M60_A Chain A, Beta-1,3-glucanase [Thermochaetoides thermophila]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P49426|EXG1_COCCA	7.52e-52	80	552	34	512	Glucan 1,3-beta-glucosidase OS=Cochliobolus carbonum OX=5017 GN=EXG1 PE=1 SV=1
sp|P53626|E13B_TRIHA	1.33e-41	169	554	96	483	Glucan endo-1,3-beta-glucosidase BGN13.1 OS=Trichoderma harzianum OX=5544 GN=bgn13.1 PE=1 SV=1
sp|D4B0V1|E13B_ARTBC	3.98e-36	96	552	41	599	Probable glucan endo-1,3-beta-glucosidase ARB_02077 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_02077 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000200	0.999780	CS pos: 26-27. Pr: 0.8548

TMHMM  Annotations     

There is no transmembrane helices in PMAA_009960-t26_1-p1.