CAZyme Information: PMAA_008720-t26_1-p1

Basic Information

• Species: Talaromyces marneffei
• Lineage: Ascomycota; Eurotiomycetes; ; Trichocomaceae; Talaromyces; Talaromyces marneffei
• CAZyme ID: PMAA_008720-t26_1-p1
• CAZy Family: AA5
• CAZyme Description: endoglucanase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
498		51136.96	4.6229

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TmarneffeiATCC18224	10194	441960	145	10049

• Gene Location: location=DS995906:61204-62700(+)

Full Sequence      

MMSHVATRPLALAAIAALFHQVASQQAPTPDNTVSLPTWKCTSSGGCVQQSTSIVVDWVY
HWIHTVNGSTSCTTSSGLNSALCGTEKECYTNCEISPATYDGLGIRASGNALTLNQYVTS
NGTTNSVSPRVYLLDPAGKNYEMLQLLGQEISFDVDVSNLPCGENGALYLSEMDATGGRS
QYNPAGASYGSGYCDAQCGTGSWFNGSINTGSLGSCCNEMDLWEANSQATALTPHPCSVD
GPYGCSGSACGSTGVCDKNGCGFNPYALGDHNYYGSGYTVDTSKPFTVTTQFVTSDGTKT
GALTEIRRSYVQNGKVIANAVASSSSGVSGANSITESFCTTMDSEAGTLGGLRTMGEALG
RGMVLIFSIWNDAGGSMNWLDSGNSGPCSSTAGVPSTIQANDPSTSVTFSNIKWGDIGST
GPSPGGSSSSSSSSSKSSSTTISITHSTTSSSATTTTTSTGATQTHWGQCGGTGYSGPTA
CAPPYTCKAQNPYYSQCL

Enzyme Prediction     

EC	3.2.1.4:18	3.2.1.73:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH7	29	420	2.3e-150	0.980722891566265

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395677	Glyco_hydro_7	0.0	29	417	5	431	Glycosyl hydrolase family 7.
153432	GH7_CBH_EG	1.64e-174	30	415	1	386	Glycosyl hydrolase family 7. Glycosyl hydrolase family 7 contains eukaryotic endoglucanases (EGs) and cellobiohydrolases (CBHs) that hydrolyze glycosidic bonds using a double-displacement mechanism. This leads to a net retention of the conformation at the anomeric carbon. Both enzymes work synergistically in the degradation of cellulose,which is the main component of plant cell wall, and is composed of beta-1,4 linked glycosyl units. EG cleaves the beta-1,4 linkages of cellulose and CBH cleaves off cellobiose disaccharide units from the reducing end of the chain. In general, the O-glycosyl hydrolases are a widespread group of enzymes that hydrolyze the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycoside hydrolase family 7.
197593	fCBD	2.68e-11	465	498	1	34	Fungal-type cellulose-binding domain. Small four-cysteine cellulose-binding domain of fungi
395595	CBM_1	4.53e-11	466	494	1	29	Fungal cellulose binding domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA21666.1|CBM1|GH7	0.0	2	498	1	497
AEG74551.1|CBM1|GH7	1.08e-297	6	498	2	495
GAM37432.1|CBM1|GH7|3.2.1.4	1.53e-297	6	498	2	495
AEL78899.1|CBM1|GH7	4.03e-279	6	498	2	495
EAL85859.1|CBM1|GH7	1.17e-191	12	498	8	460

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6SU8_A	4.84e-181	30	420	7	394	Chain A, Glucanase [Rasamsonia emersonii],6SU8_B Chain B, Glucanase [Rasamsonia emersonii],6SU8_C Chain C, Glucanase [Rasamsonia emersonii]
5W0A_A	1.37e-139	29	420	7	370	Crystal structure of Trichoderma harzianum endoglucanase I [Trichoderma harzianum],5W0A_B Crystal structure of Trichoderma harzianum endoglucanase I [Trichoderma harzianum]
1EG1_A	3.10e-135	29	420	7	370	Chain A, ENDOGLUCANASE I [Trichoderma reesei],1EG1_C Chain C, ENDOGLUCANASE I [Trichoderma reesei]
1GPI_A	3.80e-122	29	420	7	426	Chain A, EXOGLUCANASE I [Phanerodontia chrysosporium],1H46_X Chain X, EXOGLUCANASE I [Phanerodontia chrysosporium],1Z3T_A Chain A, cellulase [Phanerodontia chrysosporium],1Z3V_A Chain A, cellulase [Phanerodontia chrysosporium],1Z3W_A Chain A, cellulase [Phanerodontia chrysosporium]
2XSP_A	6.72e-114	29	420	7	437	Structure of Cellobiohydrolase 1 (Cel7A) from Heterobasidion annosum [Heterobasidion annosum],2YG1_A APO STRUCTURE OF CELLOBIOHYDROLASE 1 (CEL7A) FROM HETEROBASIDION ANNOSUM [Heterobasidion annosum],2YG1_B APO STRUCTURE OF CELLOBIOHYDROLASE 1 (CEL7A) FROM HETEROBASIDION ANNOSUM [Heterobasidion annosum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|G2QCS4|CEL7A_MYCTT	3.24e-165	12	498	9	464	Endoglucanase 7a OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=eg7A PE=1 SV=1
sp|A1CG87|CELB_ASPCL	6.61e-161	8	420	3	411	Probable endo-beta-1,4-glucanase celB OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=celB PE=3 SV=1
sp|Q0CC84|CELB_ASPTN	2.66e-158	9	420	7	414	Probable endo-beta-1,4-glucanase celB OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=celB PE=3 SV=1
sp|Q2TX26|CELB_ASPOR	2.44e-150	12	420	5	413	Endo-beta-1,4-glucanase celB OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=celB PE=1 SV=1
sp|B8NW70|CELB_ASPFN	2.44e-150	12	420	5	413	Probable endo-beta-1,4-glucanase celB OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=celB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000207	0.999757	CS pos: 24-25. Pr: 0.9786

TMHMM  Annotations     

There is no transmembrane helices in PMAA_008720-t26_1-p1.