CAZyme Information: PMAA_007410-t26_1-p1

Basic Information

• Species: Talaromyces marneffei
• Lineage: Ascomycota; Eurotiomycetes; ; Trichocomaceae; Talaromyces; Talaromyces marneffei
• CAZyme ID: PMAA_007410-t26_1-p1
• CAZy Family: AA4
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
275	DS995905|CGC1	30450.50	3.8181

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TmarneffeiATCC18224	10194	441960	145	10049

• Gene Location: location=DS995905:1881609-1882497(+)

Full Sequence      

MTSLLSTTAAFLVTASIAAAAANGTGKRGLVYNNNNVYGDATYANDFFAISSQVTWAYDW
GYPSHNLSLVFEFVPMLWGLPSGDAPDWTDAVQMAGTVNILGFNEPDLTYSGSSNLLPAA
AAQRYITYMERLRSTVRIGVPNVLWNNYDSTSSGGDYSSRVWTSYFMGNCTDCHFDFACI
HWYQDCEPGNSESGADWFTSNVTDAYNTLQLPLWITEFQCYGNDDQQVSFLQSVMPWLDT
QDYVERYAYFGVFPDYLLDDAGDALSAAGHAYISS

Enzyme Prediction     

No EC number prediction in PMAA_007410-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH128	48	272	9.6e-58	0.9821428571428571

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
371727	Glyco_hydro_cc	1.01e-61	37	272	1	235	Glycosyl hydrolase catalytic core. This family is probably a glycosyl hydrolase, and is conserved in fungi and some Proteobacteria. The pombe member is annotated as being from IPR013781.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA21608.1|GH128	2.66e-209	1	275	1	275
QKX55063.1|GH128	1.70e-156	9	275	9	270
QSZ35294.1|GH128	1.15e-113	26	274	145	390
CCD42301.1|GH128	4.60e-113	25	274	221	467
ATZ46318.1|GH128	4.60e-113	25	274	221	467

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6UB0_A	2.60e-34	24	272	1	227	Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with laminaribiose at -2 and -1 subsites [Blastomyces gilchristii SLH14081]
6UAY_A	3.98e-34	20	272	28	258	Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) [Blastomyces gilchristii],6UAY_B Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) [Blastomyces gilchristii],6UAZ_A Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with glucose [Blastomyces gilchristii],6UAZ_B Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with glucose [Blastomyces gilchristii],6UB1_A Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with laminaribiose at -3 and -2 subsites [Blastomyces gilchristii],6UB1_B Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with laminaribiose at -3 and -2 subsites [Blastomyces gilchristii],6UB1_C Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with laminaribiose at -3 and -2 subsites [Blastomyces gilchristii],6UB1_D Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with laminaribiose at -3 and -2 subsites [Blastomyces gilchristii]
6UBC_A	2.65e-11	23	275	192	439	Chain A, Glyco_hydro_cc domain-containing protein [Cryptococcus neoformans]
6UB7_A	4.97e-08	47	255	49	254	Chain A, Glyco_hydro_cc domain-containing protein [Cryptococcus neoformans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09788|ASL1_SCHPO	2.08e-25	25	274	294	530	Alkali-sensitive linkage protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=asl1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000782	0.999183	CS pos: 20-21. Pr: 0.9823

TMHMM  Annotations     

There is no transmembrane helices in PMAA_007410-t26_1-p1.