CAZyme Information: PMAA_004960-t26_1-p1

Basic Information

• Species: Talaromyces marneffei
• Lineage: Ascomycota; Eurotiomycetes; ; Trichocomaceae; Talaromyces; Talaromyces marneffei
• CAZyme ID: PMAA_004960-t26_1-p1
• CAZy Family: AA3
• CAZyme Description: alpha

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
962	DS995905|CGC6	106561.42	6.2854

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TmarneffeiATCC18224	10194	441960	145	10049

• Gene Location: location=DS995905:1235327-1238320(-)

Full Sequence      

MAYEQGAPDKIPPNQPNPVIVGPGLSALGEEAYIEASTVTPPIVSAATAAGNADGAENPR
EPKQDESAASYFSEVPGTATAPKDAYVNPPMSPADAASGATSGPELLRRLSLIDNAHPTP
ATPVIDPRADHPGLQLTGRIISASLCIPYKVAHQAGQDWELSPRAGTSALFDSFAHLASD
QSPWNHTLVAWTGEVEEIVTKRAPLQSVTASGVNTVATAPPPVNKASAPVPVDLSQNSQT
PTPVEGILVSSADRERLERQLKASKYGKILPVWATAESDEPSDDILLQDQSRWRRYAERE
LYPLLHYKQNGPSDGRSERKWWTDYMRLNRLFADRIARIYQAGDIVWIHDYHLFLLPSLL
RQRIPNIFIGFFLHSPFPSSEYMRCLAKRKEVLTGVLGANMIGFQTYSYSRHFSSCCTRV
LGFESNAAGVDAYGAHVAVDVFATGIDAQNVQKAAFGSSGIEEVVANIKKLYAGKKIIVG
RDRLDSVRGVAQKLQAFEAFLEKYPHWRDQVVLIQVTSPTSMEEQKEDPENKIGSQVSSL
VSTINGRFGSLSFTPVQYYPQYISQQDYFCLLRVADVGLITSVRDGMNTTSLEYVLCQQG
NHGPLILSEFSGTAAMLTSAIHINPWDTTGVATAIDQALSMSAEEKLERHDVAYKHVTSN
TVSMWSQHFINRLLTNLSSFDQSIATPALDRALVLKQYRKAKKRLFMFDYDGTLTPIVKD
PQAAIPSDRVLRNIKSLAADPRNSVWIISGRDQAFLDEWMGHIPELGLSAEHGCFIRKPR
SDDWENLAAKFNMEWQKDVMDVFQHYTERTQGSFIERKRVALTWHYRRADPEYGAFQAKE
CRKHLENTVMKKFDVEVMTGKANLEVRPTFVNKGFIVTRLLNEYGRGPGDAPEFIFCSGD
DFTDEDMFRALRHSDLPPEHIFSVTVGASSKQTLAGWHLLEPADVIATIGMLNGTSMGAE
YS

Enzyme Prediction     

EC	3.1.3.12:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT20	134	673	2e-153	0.9768421052631578

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
184712	PRK14501	0.0	296	945	90	716	putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional
340820	GT20_TPS	0.0	246	673	50	462	trehalose-6-phosphate synthase. Trehalose-6-Phosphate Synthase (TPS, EC 2.4.1.15) is a glycosyltransferase that catalyses the synthesis of alpha,alpha-1,1-trehalose-6-phosphate from glucose-6-phosphate using a UDP-glucose donor. It is a key enzyme in the trehalose synthesis pathway. Trehalose is a nonreducing disaccharide present in a wide variety of organisms and may serve as a source of energy and carbon. It is characterized most notably in insect, plant, and microbial cells. Its production is often associated with a variety of stress conditions, including desiccation, dehydration, heat, cold, and oxidation. This family represents the catalytic domain of the TPS. Some members of this domain family coexist with a C-terminal trehalose phosphatase domain.
395781	Glyco_transf_20	4.48e-173	271	673	77	468	Glycosyltransferase family 20. Members of this family belong to glycosyl transferase family 20. OtsA (Trehalose-6-phosphate synthase) is homologous to regions in the subunits of yeast trehalose-6-phosphate synthase/phosphate complex,.
215556	PLN03064	1.55e-155	296	908	181	807	alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional
223457	OtsA	7.51e-154	290	673	98	477	Trehalose-6-phosphate synthase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA21380.1|GT20	0.0	1	962	1	962
QKX64437.1|GT20	0.0	1	961	1	944
BCR91687.1|GT20	0.0	10	961	8	957
BCS16698.1|GT20	0.0	1	961	1	946
QMW46130.1|GT20	0.0	1	956	1	941

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5DXN_A	1.17e-159	684	953	1	270	Structure of Aspergillus fumigatus trehalose-6-phosphate phosphatase crystal form 2 [Aspergillus fumigatus Af293],5DXO_A Structure of Aspergillus fumigatus trehalose-6-phosphate phosphatase crystal form 3 [Aspergillus fumigatus Af293],5DXO_B Structure of Aspergillus fumigatus trehalose-6-phosphate phosphatase crystal form 3 [Aspergillus fumigatus Af293]
5DXL_A	1.56e-153	686	955	3	272	Structure of Aspergillus fumigatus trehalose-6-phosphate phosphatase crystal form 1 [Aspergillus fumigatus Af293]
5DXF_A	1.79e-148	134	676	27	526	Structure of Candida albicans trehalose-6-phosphate phosphatase N-terminal domain [Candida albicans SC5314],5DXF_B Structure of Candida albicans trehalose-6-phosphate phosphatase N-terminal domain [Candida albicans SC5314]
5DXI_A	4.86e-98	686	954	5	299	Structure of C. albicans Trehalose-6-phosphate phosphatase C-terminal domain [Candida albicans SC5314],5DXI_B Structure of C. albicans Trehalose-6-phosphate phosphatase C-terminal domain [Candida albicans SC5314]
5HVM_A	2.83e-89	246	673	62	474	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVM_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P31688|TPS2_YEAST	3.39e-231	139	954	15	848	Trehalose-phosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TPS2 PE=1 SV=3
sp|P78875|TPP1_SCHPO	9.63e-221	124	946	24	806	Trehalose-phosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tpp1 PE=1 SV=2
sp|Q9P4D3|TPS2_ZYGRO	8.15e-209	139	954	10	855	Trehalose-phosphatase OS=Zygosaccharomyces rouxii OX=4956 GN=TPS2 PE=1 SV=1
sp|O14145|TPS2_SCHPO	1.66e-172	139	945	16	842	Trehalose-phosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tps2 PE=3 SV=1
sp|Q54NU9|TPSB_DICDI	9.25e-164	288	911	134	750	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] B OS=Dictyostelium discoideum OX=44689 GN=tpsB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000046	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PMAA_004960-t26_1-p1.