CAZyme Information: PMAA_002420-t26_1-p1

Basic Information

• Species: Talaromyces marneffei
• Lineage: Ascomycota; Eurotiomycetes; ; Trichocomaceae; Talaromyces; Talaromyces marneffei
• CAZyme ID: PMAA_002420-t26_1-p1
• CAZy Family: AA1
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
583	DS995905|CGC12	64164.13	4.4490

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TmarneffeiATCC18224	10194	441960	145	10049

• Gene Location: location=DS995905:521175-522926(-)

Full Sequence      

MRLTFFHITFLLSYAVALTRPRFILPNHAIQPISDEPQPNDAEHMANRRPHSPSVGDVEK
DFQQSFTSPFQVVGQSGVPAMAAALMPNGNVVFVDKVENYTQLVLDNGQYAYSAEYNLTT
NTAHGLALNTNAFCSGGSFLADGRLASIGGNGPLPEIDSTVGDGFQGIRYLGRGVYYDDL
YDNWYEPGHLLSTPRWYASVQMLQDNRLFVASGSLNGMDPMQNENNNPTFEILDADGIPA
NESTILPILSSNQPYYMYPFLHLLKNGQLFIFVSRSAEIYNPDSQETSLRLPNLPGTYRT
YPNTGGSVLLPLSKENDWEPEIIICGGGAYADIASPADRTCGRIMPLSESAEWHMEEMPE
PRVMVEGLLLPDGKVLWLNGARRGAQGFGTAQEPCFGALIYDPKQPSERRWSHEGTSNIP
RLYHSVALLLLDGTVMIAGSNPVEQPLLEPDYSSPETSYVTEFRVEIYTPPYLSGENASR
RPQDIKFSQTNLTTDGEFVITFTSATNSTDLKIALYHGGFVTHLLHMGQRLVFLENEGFS
PGLEEQVVNVSMPASSSIAPSGPYVIYVVLDGVPGLGQFVLMS

Enzyme Prediction     

No EC number prediction in PMAA_002420-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA5	68	582	3.8e-140	0.9467140319715808

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
399910	Glyoxal_oxid_N	2.83e-43	81	327	1	243	Glyoxal oxidase N-terminus. This family represents the N-terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes. Glyoxal oxidase catalyzes the oxidation of aldehydes to carboxylic acids, coupled with reduction of dioxygen to hydrogen peroxide. It is an essential component of the extracellular lignin degradation pathways of the wood-rot fungus Phanerochaete chrysosporium.
401164	DUF1929	7.65e-23	488	580	2	89	Domain of unknown function (DUF1929). Members of this family adopt a secondary structure consisting of a bundle of seven, mostly antiparallel, beta-strands surrounding a hydrophobic core. The 7 strands are arranged in 2 sheets, in a Greek-key topology. Their precise function, has not, as yet, been defined, though they are mostly found in sugar-utilising enzymes, such as galactose oxidase.
199882	E_set_GO_C	1.08e-18	482	582	13	103	C-terminal Early set domain associated with the catalytic domain of galactose oxidase. E or "early" set domains are associated with the catalytic domain of galactose oxidase at the C-terminal end. Galactose oxidase is an extracellular monomeric enzyme which catalyzes the stereospecific oxidation of a broad range of primary alcohol substrates and possesses a unique mononuclear copper site essential for catalyzing a two-electron transfer reaction during the oxidation of primary alcohols to corresponding aldehydes. The second redox active center necessary for the reaction was found to be situated at a tyrosine residue. The C-terminal domain of galactose oxidase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase, among others.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA21118.1|AA5	0.0	1	583	1	583
QKX63834.1|AA5	7.97e-253	14	583	13	568
QSS69861.1|AA5|CBM18	1.84e-220	70	583	114	628
QSS64055.1|AA5|CBM18	3.00e-219	70	583	114	628
QRC90698.1|AA5|CBM18	3.79e-219	74	583	322	827

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2WQ8_A	3.72e-11	46	583	154	660	Chain A, GALACTOSE OXIDASE [Fusarium graminearum]
2EIC_A	4.80e-11	46	583	132	638	Chain A, Galactose oxidase [Fusarium graminearum]
1GOF_A	8.36e-11	46	583	132	638	NOVEL THIOETHER BOND REVEALED BY A 1.7 ANGSTROMS CRYSTAL STRUCTURE OF GALACTOSE OXIDASE [Hypomyces rosellus],1GOG_A NOVEL THIOETHER BOND REVEALED BY A 1.7 ANGSTROMS CRYSTAL STRUCTURE OF GALACTOSE OXIDASE [Hypomyces rosellus],1GOH_A NOVEL THIOETHER BOND REVEALED BY A 1.7 ANGSTROMS CRYSTAL STRUCTURE OF GALACTOSE OXIDASE [Hypomyces rosellus],2EIE_A Chain A, Galactose oxidase [Fusarium graminearum],2JKX_A Chain A, GALACTOSE OXIDASE [Fusarium graminearum],2VZ1_A Chain A, GALACTOSE OXIDASE [Fusarium graminearum],2VZ3_A Chain A, Galactose Oxidase [Fusarium graminearum]
1T2X_A	8.36e-11	46	583	132	638	Glactose oxidase C383S mutant identified by directed evolution [Fusarium sp.]
2EIB_A	1.10e-10	46	583	132	638	Chain A, Galactose oxidase [Fusarium graminearum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q3HRQ2|GLOX_VITPS	4.05e-65	72	580	20	519	Aldehyde oxidase GLOX OS=Vitis pseudoreticulata OX=231512 GN=GLOX PE=2 SV=1
sp|Q9FYG4|GLOX1_ARATH	4.44e-54	76	580	105	612	Aldehyde oxidase GLOX1 OS=Arabidopsis thaliana OX=3702 GN=GLOX1 PE=2 SV=1
sp|A0A2H4HHY6|GLOX_ARTAN	1.58e-53	76	580	77	591	Putative aldehyde oxidase Art an 7 OS=Artemisia annua OX=35608 PE=1 SV=1
sp|Q01772|GLOX_PHACH	1.46e-50	76	583	35	550	Aldehyde oxidase GLOX OS=Phanerodontia chrysosporium OX=2822231 GN=GLX PE=1 SV=1
sp|D4AUF1|WSCD1_ARTBC	2.57e-45	88	580	440	901	WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_07867 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000590	0.999385	CS pos: 17-18. Pr: 0.9555

TMHMM  Annotations     

There is no transmembrane helices in PMAA_002420-t26_1-p1.