CAZyme Information: PMAA_001970-t26_1-p1

Basic Information

• Species: Talaromyces marneffei
• Lineage: Ascomycota; Eurotiomycetes; ; Trichocomaceae; Talaromyces; Talaromyces marneffei
• CAZyme ID: PMAA_001970-t26_1-p1
• CAZy Family: AA1
• CAZyme Description: glycosyl transferase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
803		90158.27	7.2716

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TmarneffeiATCC18224	10194	441960	145	10049

• Gene Location: location=DS995905:407456-409996(+)

Full Sequence      

MSGYHNGHYGGTTSPYGNGNNGNPNAYYGNNTYGYGEEMVEFDVLNHGHGQNDAAYMNSV
NMNDHYDPNERHIGRSPPKPIRPGLQPADDFASPMGSPLGTPGGQMGWPLPTRRGHDRHV
DSFASVSSTPAGSRSATPAFIRQYQNNQSFQSHQSLAALVDQPPSPLYSKDWVQQGSIAR
VADRDDVDIWKGWRRYVYMLVPFLTFGNTAIYIFYLGLRITCVILAQNAANQTYAGAWVF
IALELATAIPSMMHNAWTMWALKGRQRPKLRLTGDDCPNVDVFITCCGEDDEVVIDTVHA
AADQDYPLDKFRVIVLDDAKSSSLEASVRQLALTYPNVHYMARTKIPGVPHHFKAGNLNY
GLEQTRLMPGGAGQFMAALDADMIPEQQWLRATLPHLLIDPKMALVCPPQLFYNCPPADP
LAQSLDFFVHVIEPIKDALGVAWCTGSGYVVRREALDDIGQFPLGSLAEDVATSTLMLGK
GWRTAYIHEALQYGTVPEDYGGHLKQRTRWAIGTVDTAFKLKFCLWGDAIKEMSFAQRFS
GFLYATLSLYTILLTASLFAIPIILIWGRPLVAYATNEQLKYLIWACFASTMSNRLCEFA
LFIPAGYHTGQRGSRYGMWMSPYLALCIIRSFFLPKWLGGQTQAFKPTGSLGSALEERDP
KRRKGMVRRLWTILVNYMAMFHFAFVYLTIVAVCLSSYRCFFQNDPNNFKNVFLCLITHA
FWPPVTFLFVITSLWTPIAYAIDPPSMPDREDLLKRDPKTGVAHPTPESKKIAFAGQEAW
FEFEYTFATLFTIFVFVYSFFYI

Enzyme Prediction     

EC	2.4.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	278	512	1.9e-25	0.991304347826087

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133043	CESA_CelA_like	1.80e-101	278	518	1	234	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
224136	BcsA	1.56e-41	236	638	12	404	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
236918	bcsA	1.71e-32	278	558	260	532	cellulose synthase catalytic subunit; Provisional
133045	CESA_like	3.82e-24	282	470	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
133057	CESA_NdvC_like	4.21e-24	286	515	6	229	NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. Bradyrhizobium japonicum synthesizes periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans during growth under hypoosmotic conditions. Two genes (ndvB, ndvC) are involved in the beta-(1, 3), beta-(1,6)-glucan synthesis. The ndvC mutant strain resulted in synthesis of altered cyclic beta-glucans composed almost entirely of beta-(1, 3)-glycosyl linkages. The periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans function for osmoregulation. The ndvC mutation also affects the ability of the bacteria to establish a successful symbiotic interaction with host plant. Thus, the beta-glucans may function as suppressors of a host defense response.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA21077.1|GT2	0.0	1	803	1	800
XP_748682.1|GT2|2.4.1.-	0.0	113	802	20	727
EAL86644.1|GT2|2.4.1.-	0.0	113	802	20	727
CAP86064.1|GT2	0.0	80	800	46	751
QQK47888.1|GT2	0.0	119	800	4	683

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EJ1_A	3.60e-22	272	513	122	374	Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4HG6_A	4.08e-22	272	513	134	386	Chain A, Cellulose Synthase Subunit A [Cereibacter sphaeroides]
4P00_A	4.09e-22	272	513	135	387	Chain A, Cellulose Synthase A subunit [Cereibacter sphaeroides 2.4.1],4P02_A Chain A, Cellulose Synthase subunit A [Cereibacter sphaeroides 2.4.1],5EIY_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1],5EJZ_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
6YV7_B	8.15e-09	303	498	66	250	Mannosyltransferase PcManGT from Pyrobaculum calidifontis [Pyrobaculum calidifontis JCM 11548],6YV8_B Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP and Mn2+ [Pyrobaculum calidifontis JCM 11548],6YV9_A Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP-Man and Mn2+ [Pyrobaculum calidifontis JCM 11548]
6YV7_A	8.19e-09	303	498	67	251	Mannosyltransferase PcManGT from Pyrobaculum calidifontis [Pyrobaculum calidifontis JCM 11548],6YV8_A Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP and Mn2+ [Pyrobaculum calidifontis JCM 11548],6YV9_B Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP-Man and Mn2+ [Pyrobaculum calidifontis JCM 11548]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P19449|BCSA1_KOMXY	5.59e-28	275	630	146	479	Cellulose synthase catalytic subunit [UDP-forming] OS=Komagataeibacter xylinus OX=28448 GN=bcsA PE=1 SV=1
sp|O82859|BCSA2_KOMSB	5.62e-28	275	630	146	481	Cellulose synthase catalytic subunit [UDP-forming] OS=Komagataeibacter sucrofermentans (strain ATCC 700178 / DSM 15973 / CECT 7291 / JCM 9730 / LMG 18788 / BPR 2001) OX=1307942 GN=bcsA PE=3 SV=1
sp|P0CW87|ACSA1_KOMXY	1.17e-27	275	630	146	479	Cellulose synthase 1 OS=Komagataeibacter xylinus OX=28448 GN=acsAB PE=1 SV=1
sp|P58931|BCSA_PSEFS	5.05e-27	241	513	123	386	Cellulose synthase catalytic subunit [UDP-forming] OS=Pseudomonas fluorescens (strain SBW25) OX=216595 GN=bcsA PE=3 SV=2
sp|Q9WX75|BCSA5_KOMXY	1.83e-26	200	515	71	375	Putative cellulose synthase 3 OS=Komagataeibacter xylinus OX=28448 GN=bcsABII-B PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000047	0.000003

TMHMM  Annotations     

Start	End
196	218
239	261
545	567
673	695
720	742
780	802