CAZyme Information: PMAA_001330-t26_1-p1

Basic Information

• Species: Talaromyces marneffei
• Lineage: Ascomycota; Eurotiomycetes; ; Trichocomaceae; Talaromyces; Talaromyces marneffei
• CAZyme ID: PMAA_001330-t26_1-p1
• CAZy Family: AA1
• CAZyme Description: endochitinase precursor, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
397		41534.98	4.6201

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TmarneffeiATCC18224	10194	441960	145	10049

• Gene Location: location=DS995905:232645-233908(-)

Full Sequence      

MQISTALISLGLLASSVVAAPHRLKARAPGGEVVVYWGQNAAAASENNDLSTYCTSSSGI
DIVVLAFLYEYGNGITIPSGVIGQDCSISTSGQGSNCGNLARQISTCQSHGVKVILSLGG
AVGAYSLTSQAEAETIGQHLWDAYGNTSGGSIPRPFGSVFVNGWDFDIEASSGNQYYQYM
ISKLRSNFASDSAHTYYITGAPQCPVPEPNMGQIITAAQFDYLWIQFYNNPYCSYPNTLN
YHDWVSYVSGTPSAHAKLFLGVPASELGSTGTQSGAVYYQSPSVLASTVASFDTSSNWGG
IMMWDAAFSDANMVNGCTYAQQASSILKTGSPCGGTGTTPPPPTTTSTSPTTSPTSPATG
TPVAQWGQCGGQGYTGSTVCASPYHCVTESIWWASCQ

Enzyme Prediction     

EC	3.2.1.14:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	32	310	1.8e-24	0.9358108108108109

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
119356	GH18_hevamine_XipI_class_III	1.05e-96	31	323	1	278	This conserved domain family includes xylanase inhibitor Xip-I, and the class III plant chitinases such as hevamine, concanavalin B, and PPL2, all of which have a glycosyl hydrolase family 18 (GH18) domain. Hevamine is a class III endochitinase that hydrolyzes the linear polysaccharide chains of chitin and peptidoglycan and is important for defense against pathogenic bacteria and fungi. PPL2 (Parkia platycephala lectin 2) is a class III chitinase from Parkia platycephala seeds that hydrolyzes beta(1-4) glycosidic bonds linking 2-acetoamido-2-deoxy-beta-D-glucopyranose units in chitin.
395573	Glyco_hydro_18	1.04e-13	33	306	2	304	Glycosyl hydrolases family 18.
119350	GH18_chitinase_D-like	3.18e-09	57	304	25	293	GH18 domain of Chitinase D (ChiD). ChiD, a chitinase found in Bacillus circulans, hydrolyzes the 1,4-beta-linkages of N-acetylglucosamine in chitin and chitodextrins. The domain architecture of ChiD includes a catalytic glycosyl hydrolase family 18 (GH18) domain, a chitin-binding domain, and a fibronectin type III domain. The chitin-binding and fibronectin type III domains are located either N-terminal or C-terminal to the catalytic domain. This family includes exochitinase Chi36 from Bacillus cereus.
395595	CBM_1	9.35e-09	365	393	1	29	Fungal cellulose binding domain.
197593	fCBD	8.09e-08	364	397	1	34	Fungal-type cellulose-binding domain. Small four-cysteine cellulose-binding domain of fungi

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA21006.1|CBM1|GH18	3.12e-290	1	397	1	397
QKX63710.1|CBM1|GH18	9.12e-194	1	397	1	411
EAL85097.1|GH18	3.96e-162	1	333	1	334
ACQ02288.1|GH18	1.88e-160	1	333	21	354
QKX55338.1|CBM1|GH18	1.61e-153	3	397	7	419

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2UY2_A	1.26e-61	27	331	2	291	ScCTS1_apo crystal structure [Saccharomyces cerevisiae],2UY3_A ScCTS1_8-chlorotheophylline crystal structure [Saccharomyces cerevisiae],2UY4_A ScCTS1_acetazolamide crystal structure [Saccharomyces cerevisiae],2UY5_A ScCTS1_kinetin crystal structure [Saccharomyces cerevisiae],4TXE_A ScCTS1 in complex with compound 5 [Saccharomyces cerevisiae]
1HVQ_A	2.08e-43	31	312	1	263	CRYSTAL STRUCTURES OF HEVAMINE, A PLANT DEFENCE PROTEIN WITH CHITINASE AND LYSOZYME ACTIVITY, AND ITS COMPLEX WITH AN INHIBITOR [Hevea brasiliensis],1LLO_A Chain A, HEVAMINE [Hevea brasiliensis],2HVM_A Hevamine A At 1.8 Angstrom Resolution [Hevea brasiliensis]
2XVN_A	2.67e-43	33	327	3	307	A. fumigatus chitinase A1 phenyl-methylguanylurea complex [Aspergillus fumigatus],2XVN_B A. fumigatus chitinase A1 phenyl-methylguanylurea complex [Aspergillus fumigatus],2XVN_C A. fumigatus chitinase A1 phenyl-methylguanylurea complex [Aspergillus fumigatus]
4TX6_A	2.74e-43	33	327	4	308	AfChiA1 in complex with compound 1 [Aspergillus fumigatus A1163],4TX6_B AfChiA1 in complex with compound 1 [Aspergillus fumigatus A1163]
2XTK_A	2.74e-43	33	327	4	308	ChiA1 from Aspergillus fumigatus in complex with acetazolamide [Aspergillus fumigatus A1163],2XTK_B ChiA1 from Aspergillus fumigatus in complex with acetazolamide [Aspergillus fumigatus A1163],2XUC_A Natural product-guided discovery of a fungal chitinase inhibitor [Aspergillus fumigatus],2XUC_B Natural product-guided discovery of a fungal chitinase inhibitor [Aspergillus fumigatus],2XUC_C Natural product-guided discovery of a fungal chitinase inhibitor [Aspergillus fumigatus],2XVP_A ChiA1 from Aspergillus fumigatus, apostructure [Aspergillus fumigatus A1163],2XVP_B ChiA1 from Aspergillus fumigatus, apostructure [Aspergillus fumigatus A1163]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|E9F9R9|CHI2_METRA	6.20e-153	27	397	31	419	Endochitinase 2 OS=Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) OX=655844 GN=chi2 PE=3 SV=2
sp|Q4U4T0|CHI2_METAN	5.80e-151	27	397	31	419	Endochitinase 2 OS=Metarhizium anisopliae OX=5530 GN=chi2 PE=1 SV=1
sp|P29029|CHIT_YEAST	4.22e-58	27	331	23	312	Endochitinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CTS1 PE=1 SV=2
sp|P40954|CHI3_CANAL	1.91e-46	33	332	25	315	Chitinase 3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CHT3 PE=1 SV=2
sp|P40953|CHI2_CANAL	2.39e-46	12	327	7	302	Chitinase 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CHT2 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000249	0.999721	CS pos: 27-28. Pr: 0.9513

TMHMM  Annotations     

There is no transmembrane helices in PMAA_001330-t26_1-p1.