CAZyme Information: PMAA_001030-t26_1-p1

Basic Information

• Species: Talaromyces marneffei
• Lineage: Ascomycota; Eurotiomycetes; ; Trichocomaceae; Talaromyces; Talaromyces marneffei
• CAZyme ID: PMAA_001030-t26_1-p1
• CAZy Family: AA1
• CAZyme Description: glycosyl transferase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
347		39808.00	8.9543

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TmarneffeiATCC18224	10194	441960	145	10049

• Gene Location: location=DS995905:137387-138559(+)

Full Sequence      

MPSLRVRLLIVVCAVLLLSQRWWLPLGNTLFNLVSLSTRWRHASAQSWVSKDRDDFDVTF
ASYPVNQTTAGSSYQDLVPPILHHIHLGPHKPRPEWLGARDECIKYHLNWTAYIWDDNAA
EKLVKEEFPHLNDMWNNYRYPVERVDALRYMVLQKYGGVVLDFDLACKRSLGPLRRFEFV
APAAHPTGFSIGFMMASQGNEFVRDLVNNLAPYNHVWFYLPYVAVMFSTGCHYASTIFTL
QENRTSLRILGGIPGSPRLHMLNGFVDTPLFRHLGSSSWHNFDAALINWIGHLRMGSVLV
CMSFVASLMLTVYYCTCLRRRRYAAKRNKIIADKFDTEGGLSCIKDA

Enzyme Prediction     

No EC number prediction in PMAA_001030-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	97	175	5.7e-16	0.9222222222222223

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	1.82e-15	73	230	77	232	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	1.35e-09	95	178	3	90	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA20976.1|GT32	1.86e-268	1	347	1	347
QKX57091.1|GT32	3.95e-158	7	347	7	351
QMW48357.1|GT32	1.44e-117	5	322	5	320
QRD92706.1|GT32	8.23e-117	5	322	5	320
QMW36301.1|GT32	8.23e-117	5	322	5	320

PDB Hits     

PMAA_001030-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P38287|CSH1_YEAST	2.32e-31	68	284	52	264	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|P33300|SUR1_YEAST	9.44e-31	77	287	54	259	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|Q10323|IMT3_SCHPO	7.92e-28	72	292	51	267	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|O14084|IMT1_SCHPO	2.89e-26	12	290	15	272	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2
sp|Q9UT67|IMT2_SCHPO	8.95e-22	73	309	77	313	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.881948	0.118068

TMHMM  Annotations     

Start	End
296	318