CAZyme Information: PIW_T013973-RA-p1

Basic Information

• Species: Globisporangium iwayamae
• Lineage: Oomycota; NA; ; Pythiaceae; Globisporangium; Globisporangium iwayamae
• CAZyme ID: PIW_T013973-RA-p1
• CAZy Family: GT90
• CAZyme Description: Beta-glucan synthesis-associated protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
268		29215.02	4.7465

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GiwayamaeDAOMBR242034	14874	1223558	0	14874

• Gene Location: location=PiwaDAOMBR242034_SC06864:6-809(-)

Full Sequence      

MNPNQGRGAPEIDILEGAGVDVSSSIQVGPGMPTEYRIIYPTNDSSPGCVYAGSCTTPGA
NVPDVPTKVYAAKRSHRSWYQGMRYAANNFCAPDAKLKQDYKTVKASMDKGITENACSLT
NCPASRDANADLSLIDGSKTTYWGINSNGTCYPFMNGYTGAYLCSPGNPSALCEKTDVPP
SDKIKEFEYRMDALSANWPIQLAAYLDYVVYQLEWVMGEQGYVRWMLAGQPLYEIPASAV
TSPPQNAAKSNPVKVMIEEPMYMIFNVA

Enzyme Prediction     

No EC number prediction in PIW_T013973-RA-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185689	GH16_fungal_KRE6_glucanase	4.57e-05	208	268	210	267	Saccharomyces cerevisiae KRE6 and related glucanses, member of glycosyl hydrolase family 16. KRE6 is a Saccharomyces cerevisiae glucanase that participates in the synthesis of beta-1,6-glucan, a major structural component of the cell wall. It is a golgi membrane protein required for normal beta-1,6-glucan levels in the cell wall. KRE6 is closely realted to laminarinase, a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
397841	SKN1	7.66e-05	2	57	279	351	Beta-glucan synthesis-associated protein (SKN1). This family consists of the beta-glucan synthesis-associated proteins KRE6 and SKN1. Beta1,6-Glucan is a key component of the yeast cell wall, interconnecting cell wall proteins, beta1,3-glucan, and chitin. It has been postulated that the synthesis of beta1,6-glucan begins in the endoplasmic reticulum with the formation of protein-bound primer structures and that these primer structures are extended in the Golgi complex by two putative glucosyltransferases that are functionally redundant, Kre6 and Skn1. This is followed by maturation steps at the cell surface and by coupling to other cell wall macromolecules.
397841	SKN1	2.29e-04	208	266	364	419	Beta-glucan synthesis-associated protein (SKN1). This family consists of the beta-glucan synthesis-associated proteins KRE6 and SKN1. Beta1,6-Glucan is a key component of the yeast cell wall, interconnecting cell wall proteins, beta1,3-glucan, and chitin. It has been postulated that the synthesis of beta1,6-glucan begins in the endoplasmic reticulum with the formation of protein-bound primer structures and that these primer structures are extended in the Golgi complex by two putative glucosyltransferases that are functionally redundant, Kre6 and Skn1. This is followed by maturation steps at the cell surface and by coupling to other cell wall macromolecules.
185689	GH16_fungal_KRE6_glucanase	2.41e-04	6	46	126	167	Saccharomyces cerevisiae KRE6 and related glucanses, member of glycosyl hydrolase family 16. KRE6 is a Saccharomyces cerevisiae glucanase that participates in the synthesis of beta-1,6-glucan, a major structural component of the cell wall. It is a golgi membrane protein required for normal beta-1,6-glucan levels in the cell wall. KRE6 is closely realted to laminarinase, a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
185693	GH16_laminarinase_like	0.006	207	268	159	208	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ28149.1|GH16	1.14e-110	1	268	250	521
UIZ24235.1|GH16_2	4.23e-106	1	268	251	520
UIZ27996.1|GH16	3.95e-104	1	268	252	515
UIZ28152.1|GH16	5.61e-104	1	268	239	509
UIZ28151.1|GH16	8.69e-103	1	268	251	524

PDB Hits     

PIW_T013973-RA-p1 has no PDB hit.

Swiss-Prot Hits     

PIW_T013973-RA-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999883	0.000168

TMHMM  Annotations     

There is no transmembrane helices in PIW_T013973-RA-p1.