CAZyme Information: PIW_T013755-RA-p1

Basic Information

• Species: Globisporangium iwayamae
• Lineage: Oomycota; NA; ; Pythiaceae; Globisporangium; Globisporangium iwayamae
• CAZyme ID: PIW_T013755-RA-p1
• CAZy Family: GT8
• CAZyme Description: Beta-glucan synthesis-associated protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
321		34375.37	4.7895

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GiwayamaeDAOMBR242034	14874	1223558	0	14874

• Gene Location: location=PiwaDAOMBR242034_SC06283:2-966(+)

Full Sequence      

EAVFKSSNQRISACDANPGSGLNPNQGRGAPEIDLLEGAGTMISSSIQIGPGMPDDYRSV
YPVNDSAFACVYSYACKTPGANAPGIPTALYNARGHKSWYQGLRYASNNFCSMDAKLKQD
YATVKASLTKGVVANSCSLTTCPGSKDPNSDMSFIDGSTTDRWGINTNGTCFSTMNAYSG
SYLCSPGNPSSRCEQSGLKESGTAVRFEYRMDAISADWDLHVAAYTGYLVYQIEWVMGND
GYIRWMLDGQPLFEVPASTMTNPPQDAAKSNPVKIMIEEPMYLIFNVALSSSWGATPPNA
GGPCRGDGKDATTNKICDAFP

Enzyme Prediction     

No EC number prediction in PIW_T013755-RA-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185689	GH16_fungal_KRE6_glucanase	1.74e-09	212	295	190	274	Saccharomyces cerevisiae KRE6 and related glucanses, member of glycosyl hydrolase family 16. KRE6 is a Saccharomyces cerevisiae glucanase that participates in the synthesis of beta-1,6-glucan, a major structural component of the cell wall. It is a golgi membrane protein required for normal beta-1,6-glucan levels in the cell wall. KRE6 is closely realted to laminarinase, a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
185693	GH16_laminarinase_like	2.76e-08	218	299	150	219	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
397841	SKN1	1.12e-06	213	295	346	428	Beta-glucan synthesis-associated protein (SKN1). This family consists of the beta-glucan synthesis-associated proteins KRE6 and SKN1. Beta1,6-Glucan is a key component of the yeast cell wall, interconnecting cell wall proteins, beta1,3-glucan, and chitin. It has been postulated that the synthesis of beta1,6-glucan begins in the endoplasmic reticulum with the formation of protein-bound primer structures and that these primer structures are extended in the Golgi complex by two putative glucosyltransferases that are functionally redundant, Kre6 and Skn1. This is followed by maturation steps at the cell surface and by coupling to other cell wall macromolecules.
185683	Glyco_hydrolase_16	0.001	226	303	142	199	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
185691	GH16_Strep_laminarinase_like	0.006	226	312	172	249	Streptomyces laminarinase-like, member of glycosyl hydrolase family 16. Proteins similar to Streptomyces sioyaensis beta-1,3-glucanase (laminarinase) present in Actinomycetales as well as Peziomycotina. Laminarinases belong to glycosyl hydrolase family 16 and hydrolyze the glycosidic bond of the 1,3-beta-linked glucan, a major component of fungal and plant cell walls and the structural and storage polysaccharides (laminarin) of marine macro-algae. Members of the GH16 family have a conserved jelly roll fold with an active site channel.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ24235.1|GH16_2	3.97e-138	3	321	232	553
UIZ27996.1|GH16	3.29e-137	1	321	231	549
CCA24749.1|GH16	1.04e-135	1	321	82	410
CCA26187.1|GH16_2	8.98e-133	1	321	226	546
UIZ28152.1|GH16	6.28e-132	3	321	220	542

PDB Hits     

PIW_T013755-RA-p1 has no PDB hit.

Swiss-Prot Hits     

PIW_T013755-RA-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.996713	0.003329

TMHMM  Annotations     

There is no transmembrane helices in PIW_T013755-RA-p1.