CAZyme Information: PIW_T013418-RA-p1

Basic Information

• Species: Globisporangium iwayamae
• Lineage: Oomycota; NA; ; Pythiaceae; Globisporangium; Globisporangium iwayamae
• CAZyme ID: PIW_T013418-RA-p1
• CAZy Family: GT66
• CAZyme Description: Exoglucanase 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
350		37606.36	7.4059

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GiwayamaeDAOMBR242034	14874	1223558	0	14874

• Gene Location: location=PiwaDAOMBR242034_SC05503:238-1290(-)

Full Sequence      

MRLVTKGQYSTNIGSRLYLLENDSRYKLYKLLNQEFAFDVDVSKLPCGLNGALYFVQMDA
DGGKAKYAGNAAGAAYGTGYCDAQCPKDIKFINGEANVLDWKPSATDPNGGTGRYGSCCM
EMDIWEANSMSSAYTPHPCSVEAQTRCTSDTQCGAGAGNRYAGVCDKDGCDNNPFRMGNK
TFYGPGSGFQIDSTKPFTVITQFITSDKTANGDLVEIKRLFKQNGRVVENPKVAIAGIDA
VASITDKICSQAKVAFKDVDDHKAKGGLKQLTKALKKGVVLTMSLWTDHDAHCLWLDSSY
PLNRSPTEPGVTRGTCATTSGVPAAVEAQSPDATVKYSNVRVGEIGSTYL

Enzyme Prediction     

EC	3.2.1.176:83	3.2.1.132:6	3.2.1.4:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH7	2	349	3.4e-146	0.7734939759036145

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395677	Glyco_hydro_7	0.0	1	348	91	434	Glycosyl hydrolase family 7.
153432	GH7_CBH_EG	1.35e-145	1	343	86	386	Glycosyl hydrolase family 7. Glycosyl hydrolase family 7 contains eukaryotic endoglucanases (EGs) and cellobiohydrolases (CBHs) that hydrolyze glycosidic bonds using a double-displacement mechanism. This leads to a net retention of the conformation at the anomeric carbon. Both enzymes work synergistically in the degradation of cellulose,which is the main component of plant cell wall, and is composed of beta-1,4 linked glycosyl units. EG cleaves the beta-1,4 linkages of cellulose and CBH cleaves off cellobiose disaccharide units from the reducing end of the chain. In general, the O-glycosyl hydrolases are a widespread group of enzymes that hydrolyze the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycoside hydrolase family 7.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ25851.1|GH7	6.47e-168	1	349	117	464
CAD79798.1|GH7	8.75e-164	1	349	110	454
UIZ21725.1|GH7	7.22e-157	1	348	118	468
CCA21686.1|GH7	1.23e-156	1	348	189	536
CAK18913.1|GH7	1.69e-154	1	349	111	456

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2XSP_A	1.28e-155	1	349	93	438	Structure of Cellobiohydrolase 1 (Cel7A) from Heterobasidion annosum [Heterobasidion annosum],2YG1_A APO STRUCTURE OF CELLOBIOHYDROLASE 1 (CEL7A) FROM HETEROBASIDION ANNOSUM [Heterobasidion annosum],2YG1_B APO STRUCTURE OF CELLOBIOHYDROLASE 1 (CEL7A) FROM HETEROBASIDION ANNOSUM [Heterobasidion annosum]
4XNN_A	1.17e-147	1	348	96	444	Chain A, Cellobiohydrolase CHBI [Daphnia pulex],4XNN_B Chain B, Cellobiohydrolase CHBI [Daphnia pulex],5MCC_A Radiation damage to GH7 Family Cellobiohydrolase from Daphnia pulex: Dose (DWD) 1.11 MGy [Daphnia pulex],5MCC_B Radiation damage to GH7 Family Cellobiohydrolase from Daphnia pulex: Dose (DWD) 1.11 MGy [Daphnia pulex],5MCD_A Radiation damage to GH7 Family Cellobiohydrolase from Daphnia pulex: Dose (DWD) 3.27 MGy [Daphnia pulex],5MCD_B Radiation damage to GH7 Family Cellobiohydrolase from Daphnia pulex: Dose (DWD) 3.27 MGy [Daphnia pulex],5MCE_A Radiation damage to GH7 Family Cellobiohydrolase from Daphnia pulex: Dose (DWD) 5.43 MGy [Daphnia pulex],5MCE_B Radiation damage to GH7 Family Cellobiohydrolase from Daphnia pulex: Dose (DWD) 5.43 MGy [Daphnia pulex],5MCF_A Radiation damage to GH7 Family Cellobiohydrolase from Daphnia pulex: Dose (DWD) 7.59 MGy [Daphnia pulex],5MCF_B Radiation damage to GH7 Family Cellobiohydrolase from Daphnia pulex: Dose (DWD) 7.59 MGy [Daphnia pulex],5MCH_A Radiation damage to GH7 Family Cellobiohydrolase from Daphnia pulex: Dose (DWD) 9.75 MGy [Daphnia pulex],5MCH_B Radiation damage to GH7 Family Cellobiohydrolase from Daphnia pulex: Dose (DWD) 9.75 MGy [Daphnia pulex],5MCI_A Radiation damage to GH7 Family Cellobiohydrolase from Daphnia pulex: Dose (DWD) 11.9 MGy [Daphnia pulex],5MCI_B Radiation damage to GH7 Family Cellobiohydrolase from Daphnia pulex: Dose (DWD) 11.9 MGy [Daphnia pulex],5MCJ_A Radiation damage to GH7 Family Cellobiohydrolase from Daphnia pulex: Dose (DWD) 14.1 MGy [Daphnia pulex],5MCJ_B Radiation damage to GH7 Family Cellobiohydrolase from Daphnia pulex: Dose (DWD) 14.1 MGy [Daphnia pulex],5MCK_A Radiation damage to GH7 Family Cellobiohydrolase from Daphnia pulex: Dose (DWD) 16.2 MGy [Daphnia pulex],5MCK_B Radiation damage to GH7 Family Cellobiohydrolase from Daphnia pulex: Dose (DWD) 16.2 MGy [Daphnia pulex],5MCL_A Radiation damage to GH7 Family Cellobiohydrolase from Daphnia pulex: Dose (DWD) 18.4 MGy [Daphnia pulex],5MCL_B Radiation damage to GH7 Family Cellobiohydrolase from Daphnia pulex: Dose (DWD) 18.4 MGy [Daphnia pulex],5MCM_A Radiation damage to GH7 Family Cellobiohydrolase from Daphnia pulex: Dose (DWD) 20.6 MGy [Daphnia pulex],5MCM_B Radiation damage to GH7 Family Cellobiohydrolase from Daphnia pulex: Dose (DWD) 20.6 MGy [Daphnia pulex],5MCN_A Radiation damage to GH7 Family Cellobiohydrolase from Daphnia pulex: Dose (DWD) 22.7 MGy [Daphnia pulex],5MCN_B Radiation damage to GH7 Family Cellobiohydrolase from Daphnia pulex: Dose (DWD) 22.7 MGy [Daphnia pulex]
4CSI_A	2.72e-147	1	348	93	433	Chain A, CELLULASE [[Humicola] grisea var. thermoidea],4CSI_B Chain B, CELLULASE [[Humicola] grisea var. thermoidea]
4V1Z_A	5.66e-147	1	349	93	437	The 3-D structure of the cellobiohydrolase, Cel7A, from Aspergillus fumigatus [Aspergillus fumigatus],4V20_A The 3-D structure of the cellobiohydrolase, Cel7A, from Aspergillus fumigatus, disaccharide complex [Aspergillus fumigatus]
5W11_A	1.61e-146	1	348	93	433	Biochemical and structural insights into the catalytic mechanism of thermostable cellobiohydrolase Cel7A from industrially relevant fungus Myceliophthora thermophila [Thermothelomyces thermophilus],5W11_B Biochemical and structural insights into the catalytic mechanism of thermostable cellobiohydrolase Cel7A from industrially relevant fungus Myceliophthora thermophila [Thermothelomyces thermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P13860|GUX1_PHACH	7.69e-147	11	349	117	445	Exoglucanase 1 OS=Phanerodontia chrysosporium OX=2822231 GN=CBH1 PE=2 SV=1
sp|P15828|GUX1_HUMGT	2.36e-145	1	348	111	451	Exoglucanase 1 OS=Humicola grisea var. thermoidea OX=5528 GN=CBH-1 PE=1 SV=2
sp|B0Y8K2|CBHB_ASPFC	5.93e-145	1	349	119	463	Probable 1,4-beta-D-glucan cellobiohydrolase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=cbhB PE=3 SV=1
sp|Q4WM08|CBHB_ASPFU	5.93e-145	1	349	119	463	Probable 1,4-beta-D-glucan cellobiohydrolase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=cbhB PE=1 SV=1
sp|A1DNL0|CBHB_NEOFI	1.58e-144	1	349	119	463	Probable 1,4-beta-D-glucan cellobiohydrolase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=cbhB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000054	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PIW_T013418-RA-p1.