CAZyme Information: PIW_T013411-RA-p1

Basic Information

• Species: Globisporangium iwayamae
• Lineage: Oomycota; NA; ; Pythiaceae; Globisporangium; Globisporangium iwayamae
• CAZyme ID: PIW_T013411-RA-p1
• CAZy Family: GT61
• CAZyme Description: Glycoside hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
189		21486.75	4.6663

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GiwayamaeDAOMBR242034	14874	1223558	0	14874

• Gene Location: location=PiwaDAOMBR242034_SC05488:12-581(+)

Full Sequence      

FTDEEKTLVKGSADFFGLNHYGTALTEPSKDYAAGIAPPNDTTGSYGDDEGVILSDDPTW
KKTDMGWNAVPWGFQKLLLWVQHRYNPAGGIYVTENGCAWADKTKEDAQHDDFRVDFYKG
YIAGMRKAMEQGADVRGYFAWSFCDNYEWAEGYNKRFGLHWVDYETQERVPKKSAIWFGG
VIRDNGFTV

Enzyme Prediction     

EC	3.2.1.21:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	1	186	8.5e-55	0.3706293706293706

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395176	Glyco_hydro_1	2.87e-56	1	187	275	453	Glycosyl hydrolase family 1.
225343	BglB	1.56e-39	3	186	281	454	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
184102	PRK13511	3.51e-33	57	181	337	462	6-phospho-beta-galactosidase; Provisional
215435	PLN02814	1.04e-29	1	182	307	480	beta-glucosidase
215455	PLN02849	1.85e-26	1	185	309	483	beta-glucosidase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ23722.1|GH1	7.74e-99	1	188	287	474
QOD61968.1|GH1	2.16e-61	1	185	275	456
QTD37399.1|GH1	5.03e-61	1	185	275	456
UOB17187.1|GH1	8.73e-60	1	185	275	455
ABD82858.1|GH1|3.2.1.21	9.78e-60	1	187	276	461

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6Z1H_A	5.73e-44	4	186	287	449	Chain A, ANCESTRAL RECONSTRUCTED GLYCOSIDASE [synthetic construct],6Z1H_B Chain B, ANCESTRAL RECONSTRUCTED GLYCOSIDASE [synthetic construct],6Z1M_A Chain A, Ancestral reconstructed glycosidase [synthetic construct],6Z1M_B Chain B, Ancestral reconstructed glycosidase [synthetic construct],6Z1M_C Chain C, Ancestral reconstructed glycosidase [synthetic construct]
4GXP_A	1.87e-42	1	186	282	464	Chimeric Family 1 beta-glucosidase made with non-contiguous SCHEMA [Thermotoga maritima MSB8],4GXP_B Chimeric Family 1 beta-glucosidase made with non-contiguous SCHEMA [Thermotoga maritima MSB8],4GXP_C Chimeric Family 1 beta-glucosidase made with non-contiguous SCHEMA [Thermotoga maritima MSB8]
5YJ7_A	5.56e-40	1	175	303	473	Chain A, Glycoside hydrolase [Nannochloris],5YJ7_B Chain B, Glycoside hydrolase [Nannochloris],5YJ7_C Chain C, Glycoside hydrolase [Nannochloris],5YJ7_D Chain D, Glycoside hydrolase [Nannochloris]
1OD0_A	4.07e-39	4	186	300	465	Family 1 b-glucosidase from Thermotoga maritima [Thermotoga maritima],1OD0_B Family 1 b-glucosidase from Thermotoga maritima [Thermotoga maritima],1OIF_A Family 1 b-glucosidase from Thermotoga maritima [Thermotoga maritima],1OIF_B Family 1 b-glucosidase from Thermotoga maritima [Thermotoga maritima],1OIM_A Family 1 b-glucosidase from Thermotoga maritima [Thermotoga maritima],1OIM_B Family 1 b-glucosidase from Thermotoga maritima [Thermotoga maritima],1OIN_A Family 1 b-glucosidase from Thermotoga maritima [Thermotoga maritima],1OIN_B Family 1 b-glucosidase from Thermotoga maritima [Thermotoga maritima],1UZ1_A Family 1 b-glucosidase from Thermotoga maritima in complex with isofagomine lactam [Thermotoga maritima],1UZ1_B Family 1 b-glucosidase from Thermotoga maritima in complex with isofagomine lactam [Thermotoga maritima],1W3J_A Family 1 b-glucosidase from Thermotoga maritima in complex with tetrahydrooxazine [Thermotoga maritima],1W3J_B Family 1 b-glucosidase from Thermotoga maritima in complex with tetrahydrooxazine [Thermotoga maritima],2CBU_A Beta-glucosidase from Thermotoga maritima in complex with castanospermine [Thermotoga maritima],2CBU_B Beta-glucosidase from Thermotoga maritima in complex with castanospermine [Thermotoga maritima],2CBV_A Beta-glucosidase from Thermotoga maritima in complex with calystegine B2 [Thermotoga maritima],2CBV_B Beta-glucosidase from Thermotoga maritima in complex with calystegine B2 [Thermotoga maritima],2CES_A Beta-glucosidase from Thermotoga maritima in complex with glucoimidazole [Thermotoga maritima],2CES_B Beta-glucosidase from Thermotoga maritima in complex with glucoimidazole [Thermotoga maritima],2CET_A Beta-glucosidase from Thermotoga maritima in complex with phenethyl- substituted glucoimidazole [Thermotoga maritima],2CET_B Beta-glucosidase from Thermotoga maritima in complex with phenethyl- substituted glucoimidazole [Thermotoga maritima],2J75_A Beta-glucosidase from Thermotoga maritima in complex with noeuromycin [Thermotoga maritima],2J75_B Beta-glucosidase from Thermotoga maritima in complex with noeuromycin [Thermotoga maritima],2J77_A Beta-glucosidase from Thermotoga maritima in complex with deoxynojirimycin [Thermotoga maritima],2J77_B Beta-glucosidase from Thermotoga maritima in complex with deoxynojirimycin [Thermotoga maritima],2J78_A Beta-glucosidase from Thermotoga maritima in complex with gluco- hydroximolactam [Thermotoga maritima],2J78_B Beta-glucosidase from Thermotoga maritima in complex with gluco- hydroximolactam [Thermotoga maritima],2J79_A Beta-glucosidase from Thermotoga maritima in complex with galacto- hydroximolactam [Thermotoga maritima],2J79_B Beta-glucosidase from Thermotoga maritima in complex with galacto- hydroximolactam [Thermotoga maritima],2J7B_A Beta-glucosidase from Thermotoga maritima in complex with gluco- tetrazole [Thermotoga maritima],2J7B_B Beta-glucosidase from Thermotoga maritima in complex with gluco- tetrazole [Thermotoga maritima],2J7C_A Beta-glucosidase from Thermotoga maritima in complex with phenylaminomethyl-derived glucoimidazole [Thermotoga maritima],2J7C_B Beta-glucosidase from Thermotoga maritima in complex with phenylaminomethyl-derived glucoimidazole [Thermotoga maritima],2J7D_A Beta-glucosidase from Thermotoga maritima in complex with methoxycarbonyl-substituted glucoimidazole [Thermotoga maritima],2J7D_B Beta-glucosidase from Thermotoga maritima in complex with methoxycarbonyl-substituted glucoimidazole [Thermotoga maritima],2J7E_A Beta-glucosidase from Thermotoga maritima in complex with methyl acetate-substituted glucoimidazole [Thermotoga maritima],2J7E_B Beta-glucosidase from Thermotoga maritima in complex with methyl acetate-substituted glucoimidazole [Thermotoga maritima],2J7F_A Beta-glucosidase from Thermotoga maritima in complex with carboxylate- substituted glucoimidazole [Thermotoga maritima],2J7F_B Beta-glucosidase from Thermotoga maritima in complex with carboxylate- substituted glucoimidazole [Thermotoga maritima],2J7G_A Beta-glucosidase from Thermotoga maritima in complex with methyl acetic acid-substituted glucoimidazole [Thermotoga maritima],2J7G_B Beta-glucosidase from Thermotoga maritima in complex with methyl acetic acid-substituted glucoimidazole [Thermotoga maritima],2J7H_A Beta-glucosidase from Thermotoga maritima in complex with azafagomine [Thermotoga maritima],2J7H_B Beta-glucosidase from Thermotoga maritima in complex with azafagomine [Thermotoga maritima],2JAL_A Beta-glucosidase from Thermotoga maritima in complex with cyclophellitol [Thermotoga maritima],2JAL_B Beta-glucosidase from Thermotoga maritima in complex with cyclophellitol [Thermotoga maritima],2VRJ_A Beta-glucosidase from Thermotoga maritima in complex with N-octyl-5- deoxy-6-oxa-N-(thio)carbamoylcalystegine [Thermotoga maritima],2VRJ_B Beta-glucosidase from Thermotoga maritima in complex with N-octyl-5- deoxy-6-oxa-N-(thio)carbamoylcalystegine [Thermotoga maritima],2WBG_A Structure of family 1 beta-glucosidase from Thermotoga maritima in complex with 3-imino-2-oxa-(+)-castanospermine [Thermotoga maritima],2WBG_B Structure of family 1 beta-glucosidase from Thermotoga maritima in complex with 3-imino-2-oxa-(+)-castanospermine [Thermotoga maritima],2WBG_C Structure of family 1 beta-glucosidase from Thermotoga maritima in complex with 3-imino-2-oxa-(+)-castanospermine [Thermotoga maritima],2WBG_D Structure of family 1 beta-glucosidase from Thermotoga maritima in complex with 3-imino-2-oxa-(+)-castanospermine [Thermotoga maritima],2WC3_A Structure of family 1 beta-glucosidase from Thermotoga maritima in complex with 3-imino-2-oxa-(+)-8-epi-castanospermine [Thermotoga maritima],2WC3_B Structure of family 1 beta-glucosidase from Thermotoga maritima in complex with 3-imino-2-oxa-(+)-8-epi-castanospermine [Thermotoga maritima],2WC3_C Structure of family 1 beta-glucosidase from Thermotoga maritima in complex with 3-imino-2-oxa-(+)-8-epi-castanospermine [Thermotoga maritima],2WC3_D Structure of family 1 beta-glucosidase from Thermotoga maritima in complex with 3-imino-2-oxa-(+)-8-epi-castanospermine [Thermotoga maritima],2WC4_A Structure of family 1 beta-glucosidase from Thermotoga maritima in complex with 3-imino-2-thia-(+)-castanospermine [Thermotoga maritima],2WC4_B Structure of family 1 beta-glucosidase from Thermotoga maritima in complex with 3-imino-2-thia-(+)-castanospermine [Thermotoga maritima],2WC4_C Structure of family 1 beta-glucosidase from Thermotoga maritima in complex with 3-imino-2-thia-(+)-castanospermine [Thermotoga maritima],2WC4_D Structure of family 1 beta-glucosidase from Thermotoga maritima in complex with 3-imino-2-thia-(+)-castanospermine [Thermotoga maritima],5N6S_A Thermotoga maritima family 1 Glycoside hydrolase complexed with Carba-Cyclophellitol transition state mimic [Thermotoga maritima],5N6S_B Thermotoga maritima family 1 Glycoside hydrolase complexed with Carba-Cyclophellitol transition state mimic [Thermotoga maritima],5N6S_C Thermotoga maritima family 1 Glycoside hydrolase complexed with Carba-Cyclophellitol transition state mimic [Thermotoga maritima],5N6S_D Thermotoga maritima family 1 Glycoside hydrolase complexed with Carba-Cyclophellitol transition state mimic [Thermotoga maritima],5N6T_A Thermotoga maritima family 1 glycoside hydrolase complexed with a cyclophellitol analogue transition state mimic [Thermotoga maritima],5N6T_B Thermotoga maritima family 1 glycoside hydrolase complexed with a cyclophellitol analogue transition state mimic [Thermotoga maritima],5OSS_A Beta-glucosidase from Thermotoga maritima in complex with Gluco-1H-imidazole [Thermotoga maritima MSB8],5OSS_B Beta-glucosidase from Thermotoga maritima in complex with Gluco-1H-imidazole [Thermotoga maritima MSB8]
4HZ6_A	3.11e-36	4	186	277	441	crystal structure of BglB [uncultured bacterium],4HZ7_A Crystal structure of BglB with glucose [uncultured bacterium],4HZ8_A Crystal structure of BglB with natural substrate [uncultured bacterium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q08638|BGLA_THEMA	1.51e-38	4	186	278	443	Beta-glucosidase A OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=bglA PE=1 SV=1
sp|B9K7M5|BGLA_THENN	2.17e-36	3	188	275	443	1,4-beta-D-glucan glucohydrolase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NBRC 107923 / NS-E) OX=309803 GN=gghA PE=1 SV=2
sp|P10482|BGLS_CALSA	6.87e-36	14	185	298	454	Beta-glucosidase A OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=bglA PE=3 SV=1
sp|P09848|LPH_HUMAN	2.33e-35	1	187	1663	1840	Lactase/phlorizin hydrolase OS=Homo sapiens OX=9606 GN=LCT PE=1 SV=3
sp|Q7XKV2|BGL13_ORYSJ	3.37e-34	1	178	322	500	Beta-glucosidase 13 OS=Oryza sativa subsp. japonica OX=39947 GN=BGLU13 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999189	0.000833

TMHMM  Annotations     

There is no transmembrane helices in PIW_T013411-RA-p1.