CAZyme Information: PIW_T013261-RA-p1

Basic Information

• Species: Globisporangium iwayamae
• Lineage: Oomycota; NA; ; Pythiaceae; Globisporangium; Globisporangium iwayamae
• CAZyme ID: PIW_T013261-RA-p1
• CAZy Family: GT60
• CAZyme Description: Glucan 1,3-beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
433		48143.75	6.1268

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GiwayamaeDAOMBR242034	14874	1223558	0	14874

• Gene Location: location=PiwaDAOMBR242034_SC05176:211-1512(+)

Full Sequence      

MALTAITTAGGPLLLAHAETPHLSFKTADLITRTSSSITIEAQAADTLSIQQQNTTFSHI
QFSIRSGKIKSRGVNLGGWLVAEHWMSTDAEFWNGLSDDDANAGEYSAITKAADSDAARA
LIQKHHDMFITETDIKAIADAGLNTVRVPVGFWIAGFDKNDSPQQQQWSVYAKDTLKYLD
VLIRQWAKRHNLAVLISIHGAKGSQNGADHSSPTVKGKAFWSDYPENVANTVTLASFLAD
RYRADAAFMGIGLLNEPTLSTTEAVLYQYYEDAYRAIRATGNDCVLTVAPLLVQQNADAM
VGFMQRPQYTNVWVEWHPYFVWGYESTSASDLIAVSVQTEFQTRVNTWQARTNHNRLFFG
EWSFATSADKFTGDNKDQFYAFAEAQANVQNQADGGWTFWTWKASSDDSSALYPWSLRSV
LRDKRLKGFLLGK

Enzyme Prediction     

No EC number prediction in PIW_T013261-RA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	121	407	2.6e-47	0.9783393501805054

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	1.91e-25	72	424	19	381	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	7.01e-10	127	406	22	272	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ29004.1|GH5	2.02e-163	52	430	29	406
UIZ29069.1|GH5	4.82e-153	35	430	24	413
UIZ29723.1|GH5	1.24e-115	64	427	5	361
AAM18484.1|GH5	1.73e-114	60	423	9	365
CCA17636.1|GH5	9.71e-112	57	423	124	491

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EQP_A	2.01e-30	72	406	10	363	Exo-b-(1,3)-glucanase From Candida Albicans [Candida albicans]
3O6A_A	2.17e-30	72	406	15	368	F144Y/F258Y Double Mutant of Exo-beta-1,3-glucanase from Candida albicans at 2 A [Candida albicans]
1CZ1_A	2.76e-30	72	406	10	363	Exo-b-(1,3)-glucanase From Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]
2PB1_A	3.02e-30	72	406	16	369	Exo-B-(1,3)-Glucanase from Candida Albicans in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2-fluoro-B-D-glucopyranoside at 1.9 A [Candida albicans]
3N9K_A	5.62e-30	72	406	15	368	F229A/E292S Double Mutant of Exo-beta-1,3-glucanase from Candida albicans in Complex with Laminaritriose at 1.7 A [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O93983|EXG2_WICAO	6.43e-30	70	406	41	398	Glucan 1,3-beta-glucosidase 2 OS=Wickerhamomyces anomalus OX=4927 GN=EXG2 PE=3 SV=1
sp|Q96V64|EXG_BLUGR	1.19e-29	70	406	36	388	Glucan 1,3-beta-glucosidase OS=Blumeria graminis OX=34373 PE=3 SV=1
sp|P29717|EXG1_CANAL	1.91e-29	72	406	54	407	Glucan 1,3-beta-glucosidase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=XOG1 PE=1 SV=5
sp|Q5B5X8|EXGA_EMENI	4.33e-29	70	403	28	372	Probable glucan 1,3-beta-glucosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=exgA PE=3 SV=2
sp|Q12700|EXG_SCHOC	5.70e-29	70	421	41	405	Glucan 1,3-beta-glucosidase OS=Schwanniomyces occidentalis OX=27300 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.865503	0.134515

TMHMM  Annotations     

There is no transmembrane helices in PIW_T013261-RA-p1.