CAZyme Information: PIW_T011694-RA-p1

Basic Information

• Species: Globisporangium iwayamae
• Lineage: Oomycota; NA; ; Pythiaceae; Globisporangium; Globisporangium iwayamae
• CAZyme ID: PIW_T011694-RA-p1
• CAZy Family: GT4
• CAZyme Description: Endo-1,3(4)-beta-glucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
370		39902.55	8.0816

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GiwayamaeDAOMBR242034	14874	1223558	0	14874

• Gene Location: location=PiwaDAOMBR242034_SC03279:2251-3360(+)

Full Sequence      

MRLLSLFASLLLTAPLSTSAQDTWETGDLKPNATLVPYSGDMATLCAPRNVDIIAGRPIP
TNAWWGNLITCDPGNKAVSPIWPNPYALAVDTATGTFGLAYPYRMRYFGDVQANLARFYA
HAVLNDVAFSATEFSATAPVFKVVSWTDLSVKIEMRVAPTKVIESNVLSGMAYFTTSYQG
LTPRLTFGTPIASINGVSYPTGTTLMGYKFYVNTVDGNQWVLYATGGSPVSLKIESNQVL
TSPVVFNGVLRIALTFSSTQTAAYDAYRECIPTGGSMVVTSDSAYEFQWATTGDCSKGLL
HLAMPHQRTTAQGASVYLVTGMLLNSTTRGALEGLLTRTSPPVWKFVEPANIPISFYPKT
RWTNSAAAGP

Enzyme Prediction     

No EC number prediction in PIW_T011694-RA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	56	350	7.6e-47	0.409967845659164

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397619	Glyco_hydro_81	7.35e-39	56	355	12	313	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.
227785	Acf2	7.12e-29	58	358	89	390	Endoglucanase Acf2 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA25009.1|GH81	2.31e-83	22	368	64	435
UIZ20872.1|GH81	2.66e-64	29	361	88	432
UIZ20875.1|GH81	2.66e-64	29	361	88	432
UIZ20868.1|GH81	3.69e-64	29	361	88	432
UIZ20873.1|GH81	3.69e-64	29	361	88	432

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	1.04e-21	56	353	38	358	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	1.05e-21	56	353	63	383	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	8.63e-20	56	353	38	358	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5AIR7|ENG1_CANAL	3.24e-16	32	361	435	774	Endo-1,3(4)-beta-glucanase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ENG1 PE=1 SV=1
sp|P53753|ENG1_YEAST	2.27e-08	58	337	433	724	Endo-1,3(4)-beta-glucanase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSE4 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000245	0.999720	CS pos: 20-21. Pr: 0.9716

TMHMM  Annotations     

There is no transmembrane helices in PIW_T011694-RA-p1.