CAZyme Information: PIW_T011438-RA-p1

Basic Information

• Species: Globisporangium iwayamae
• Lineage: Oomycota; NA; ; Pythiaceae; Globisporangium; Globisporangium iwayamae
• CAZyme ID: PIW_T011438-RA-p1
• CAZy Family: GT30
• CAZyme Description: Protoplast secreted protein 2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
123		12858.71	10.3478

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GiwayamaeDAOMBR242034	14874	1223558	0	14874

• Gene Location: location=PiwaDAOMBR242034_SC03071:3312-3683(-)

Full Sequence      

MPTRFGSVPAQLKNFFDATGSLWQKGALIGKPAGVFFSCGSQGGGNETTALMTIPFLTHQ
GMLFVPLGTRAKQFGTLDEVVGGGKWGTGTYAGDGSRKPSERELSTAKVQGVSFAEITKK
LAA

Enzyme Prediction     

No EC number prediction in PIW_T011438-RA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA6	1	120	1e-44	0.6256410256410256

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
179647	PRK03767	9.95e-45	2	123	78	200	NAD(P)H:quinone oxidoreductase; Provisional
223728	WrbA	3.62e-29	2	121	84	205	Multimeric flavodoxin WrbA [Energy production and conversion].
397438	FMN_red	9.36e-09	2	66	78	140	NADPH-dependent FMN reductase.
223508	SsuE	0.005	2	68	76	137	NAD(P)H-dependent FMN reductase [Energy production and conversion].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SPT16511.1|AA6	1.16e-42	2	123	80	203
CDM84515.1|AA6	1.77e-41	2	121	79	199
UJR21531.1|AA6	2.31e-41	2	117	110	226
CAG86707.1|AA6	5.04e-41	1	121	77	198
ACF86423.1|AA6	5.04e-41	2	121	79	199

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MP4_A	3.06e-34	1	120	76	197	The structure of Pst2p from Saccharomyces cerevisiae [Saccharomyces cerevisiae S288C],5MP4_B The structure of Pst2p from Saccharomyces cerevisiae [Saccharomyces cerevisiae S288C],5MP4_C The structure of Pst2p from Saccharomyces cerevisiae [Saccharomyces cerevisiae S288C],5MP4_D The structure of Pst2p from Saccharomyces cerevisiae [Saccharomyces cerevisiae S288C],5MP4_E The structure of Pst2p from Saccharomyces cerevisiae [Saccharomyces cerevisiae S288C],5MP4_F The structure of Pst2p from Saccharomyces cerevisiae [Saccharomyces cerevisiae S288C],5MP4_G The structure of Pst2p from Saccharomyces cerevisiae [Saccharomyces cerevisiae S288C],5MP4_H The structure of Pst2p from Saccharomyces cerevisiae [Saccharomyces cerevisiae S288C]
3ZHO_A	7.77e-29	2	121	76	195	X-ray structure of E.coli Wrba in complex with FMN at 1.2 A resolution [Escherichia coli],3ZHO_B X-ray structure of E.coli Wrba in complex with FMN at 1.2 A resolution [Escherichia coli],4YQE_A Crystal structure of E. coli WrbA in complex with benzoquinone [Escherichia coli K-12],4YQE_B Crystal structure of E. coli WrbA in complex with benzoquinone [Escherichia coli K-12],5F12_A WrbA in complex with FMN under crystallization conditions of WrbA-FMN-BQ structure (4YQE) [Escherichia coli K-12],5F12_B WrbA in complex with FMN under crystallization conditions of WrbA-FMN-BQ structure (4YQE) [Escherichia coli K-12]
4DY4_A	7.77e-29	2	121	76	195	High resolution structure of E.coli WrbA with FMN [Escherichia coli APEC O1],4DY4_C High resolution structure of E.coli WrbA with FMN [Escherichia coli APEC O1]
2R96_A	7.97e-29	2	121	77	196	Crystal structure of E. coli WrbA in complex with FMN [Escherichia coli],2R96_C Crystal structure of E. coli WrbA in complex with FMN [Escherichia coli],2R97_A Crystal structure of E. coli WrbA in complex with FMN [Escherichia coli],2R97_C Crystal structure of E. coli WrbA in complex with FMN [Escherichia coli],2RG1_A Crystal structure of E. coli WrbA apoprotein [Escherichia coli],2RG1_B Crystal structure of E. coli WrbA apoprotein [Escherichia coli],3B6I_A WrbA from Escherichia coli, native structure [Escherichia coli K-12],3B6I_B WrbA from Escherichia coli, native structure [Escherichia coli K-12],3B6J_A WrbA from Escherichia coli, NADH complex [Escherichia coli K-12],3B6J_B WrbA from Escherichia coli, NADH complex [Escherichia coli K-12],3B6K_A WrbA from Escherichia coli, Benzoquinone complex [Escherichia coli K-12],3B6K_B WrbA from Escherichia coli, Benzoquinone complex [Escherichia coli K-12],3B6M_A WrbA from Escherichia coli, second crystal form [Escherichia coli K-12],3B6M_B WrbA from Escherichia coli, second crystal form [Escherichia coli K-12]
4LA4_A	3.94e-28	2	122	83	204	Crystal structure of native PnpB [Pseudomonas sp. WBC-3],4LA4_B Crystal structure of native PnpB [Pseudomonas sp. WBC-3],4LAF_A Crystal structure of PnpB complex with FMN [Pseudomonas sp. WBC-3],4LAF_B Crystal structure of PnpB complex with FMN [Pseudomonas sp. WBC-3],4LAF_C Crystal structure of PnpB complex with FMN [Pseudomonas sp. WBC-3],4LAF_D Crystal structure of PnpB complex with FMN [Pseudomonas sp. WBC-3]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9LSQ5|FQR1_ARATH	4.24e-40	2	121	79	199	NAD(P)H dehydrogenase (quinone) FQR1 OS=Arabidopsis thaliana OX=3702 GN=FQR1 PE=1 SV=1
sp|Q9AYU0|QR2_TRIVS	7.05e-39	2	121	79	200	Quinone-oxidoreductase QR2 OS=Triphysaria versicolor OX=64093 PE=1 SV=1
sp|Q6NQE2|FQRL1_ARATH	2.83e-38	2	121	79	199	Probable NAD(P)H dehydrogenase (quinone) FQR1-like 1 OS=Arabidopsis thaliana OX=3702 GN=At4g27270 PE=1 SV=1
sp|P42058|ALTA7_ALTAL	2.52e-36	1	120	79	201	Minor allergen Alt a 7 OS=Alternaria alternata OX=5599 GN=ALTA7 PE=1 SV=1
sp|O23207|FQRL2_ARATH	1.01e-35	2	122	150	271	Probable NAD(P)H dehydrogenase (quinone) FQR1-like 2 OS=Arabidopsis thaliana OX=3702 GN=At4g36750 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000062	0.000003

TMHMM  Annotations     

There is no transmembrane helices in PIW_T011438-RA-p1.