CAZyme Information: PIW_T011124-RA-p1

Basic Information

• Species: Globisporangium iwayamae
• Lineage: Oomycota; NA; ; Pythiaceae; Globisporangium; Globisporangium iwayamae
• CAZyme ID: PIW_T011124-RA-p1
• CAZy Family: GT20
• CAZyme Description: Choline dehydrogenase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
566		61406.61	6.1379

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GiwayamaeDAOMBR242034	14874	1223558	0	14874

• Gene Location: location=PiwaDAOMBR242034_SC02849:1566-3999(-)

Full Sequence      

SLLALAFFREDTAPASVVVGSTDGEEFDAIVIGGGPAGSVVSKLLSDDPWRKVLLIEAGD
ASQAELGGKAPIESALNVEGLTPFDVPFYWTNVANTPRLHWDYPGVNVAKALGGCGIHNA
MLYVRALPRDMDRWAMKNWTWAKALEIYLQMEDFEGPNSTYHSNQGFVRTSEPGLRDHLS
EEFIQACEQYGLPRTADFNAPGGRFGAGYYHFNTRNGVRESAARTFLGPLLLGTAQSQQA
NFRILLSTVVSKIVINEATEAEGVEIVGPDGVSKMIRLSKRGHVVVTAGAINTPKVLMMS
GIGDESVLHRLNITVKKHLSRVGMNLQDHPVLGVTFESLAPHVFDLQTETEHYFKAKDAN
SKNASSYGLLGSAGISAGAFLIPPGSTTPEIQLTFFPRKSEPHISNSSGLNHTAEILFTV
ALLTPKARNRVILVPRSNESGAELVPRVASEVPEVEQEEHLRGDDVWKLSWGVSVVREIA
SVLDLNAWVLGAVFRNSHWVGSAAMANSEEEGVVDNHLRVFGVKRLRVADASVIPAIPNG
NVHSSVLMVASHAAELIRTDEKLTER

Enzyme Prediction     

No EC number prediction in PIW_T011124-RA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	26	559	6.8e-96	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	1.11e-76	21	563	2	539	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	7.56e-66	25	558	4	532	choline dehydrogenase; Validated
366272	GMC_oxred_N	1.55e-31	109	331	24	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
398739	GMC_oxred_C	1.48e-19	484	553	74	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	3.67e-13	1	549	27	568	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ22502.1|AA3_2	2.08e-249	27	561	83	643
QWC20507.1|AA3_2	8.69e-51	25	558	4	525
BDA51473.1|AA3	5.70e-49	25	557	48	600
CAD7197545.1|AA3_2	8.84e-47	26	559	56	605
CAD7260507.1|AA3_2	2.20e-46	26	559	9	558

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YS2_AAA	9.30e-49	24	557	5	560	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
6YS1_AAA	1.28e-48	24	557	5	560	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
6YRU_AAA	1.28e-48	24	557	5	560	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRV_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRX_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRZ_AAA Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
5NCC_A	1.63e-48	24	557	21	576	Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_B Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_C Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_D Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_E Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_F Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis]
7AV4_AAA	4.97e-48	24	557	81	636	Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A248QE08|FAP_CHLVA	1.86e-47	24	557	81	636	Fatty acid photodecarboxylase, chloroplastic OS=Chlorella variabilis OX=554065 GN=FAP PE=1 SV=1
sp|Q8BJ64|CHDH_MOUSE	1.28e-44	3	566	19	582	Choline dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Chdh PE=1 SV=1
sp|A8JHB7|FAP_CHLRE	1.55e-44	20	558	39	597	Fatty acid photodecarboxylase, chloroplastic OS=Chlamydomonas reinhardtii OX=3055 GN=FAP PE=1 SV=1
sp|H6AGY0|EO_BOMMO	2.97e-44	23	558	44	592	Ecdysone oxidase OS=Bombyx mori OX=7091 GN=EO PE=1 SV=1
sp|P0DO29|ERIK_HERER	3.43e-44	27	558	34	596	Dehydrogenase eriK OS=Hericium erinaceus OX=91752 GN=eriK PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999987	0.000091

TMHMM  Annotations     

There is no transmembrane helices in PIW_T011124-RA-p1.